DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and hrg-7

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001256448.1 Gene:hrg-7 / 182635 WormBaseID:WBGene00007605 Length:428 Species:Caenorhabditis elegans


Alignment Length:420 Identity:121/420 - (28%)
Similarity:185/420 - (44%) Gaps:72/420 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QFQASFMASRRQHRAGRSSLLAKYNVVGGQEVTSRN----GGATETLDNRLNLEYAGPISIGSPG 91
            ||...:..:.|| |......||:|.....:.::.::    ..::..:|.. ::.|...||:|||.
 Worm    20 QFNIGYRPNMRQ-RMNAKGKLAEYEKERNELLSKKSLQLASSSSPVIDYE-DMAYMVQISLGSPA 82

  Fly    92 QPFNMLFDTGSANLWVP----------------------------SAECSPKSV----------A 118
            |.|.:..|:||:|||||                            ..||..|:|          |
 Worm    83 QNFVLFIDSGSSNLWVPDITCAGGKDATCGSYCKSTPYDACLTFCQEECCTKTVEGVKVLSTTDA 147

  Fly   119 CHHHHRYNASASSTFVPDGRRFSIAYGTGSLSGRLAQDTVAIGQLVV--QNQTFGMATHEPGPTF 181
            |...||:|:|.||::|.:|::|.:.|.||.:.|....||.......|  ..|.||.|| ..|..|
 Worm   148 CQSKHRFNSSLSSSYVTNGQKFDMTYNTGEVKGFFGVDTFCFTNTSVCATGQVFGQAT-TIGEAF 211

  Fly   182 VDTNFAGIVGLGFRPIA-ELGIKPLFESMCDQQLVDECVFSFYLKRNG--SERKGGELLFGGVDK 243
            ......||:|||:..:| .....|||..| :|..:|:..|..||...|  |:..||....||:|.
 Worm   212 AKQPEDGIIGLGWPALAVNQQTPPLFNLM-NQGKLDQPYFVVYLANIGPTSQINGGAFTVGGLDT 275

  Fly   244 TKFSGSLTYVPLTHAGYWQFPLDVIEVAGT---RINQNRQAIADTGTSLLAAPPREYLIINSLLG 305
            |..|.::.:|||:...:|||.|..:. :|:   ..|...||.|||..|.:.||..   ::.||..
 Worm   276 THCSSNVDWVPLSTQTFWQFKLGGVS-SGSYSQAPNSGWQAAADTAASFIGAPKS---VVTSLAK 336

  Fly   306 GLPTS----NNEYLLNCSEIDSLPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAFTLMDA- 365
            .:..:    ...:.::|..:  :|:|||.|.|:.:.:....:|:||    |...|:.||..:.| 
 Worm   337 AVGATYVPLTGAFFMDCDAV--VPDIVFTINGKTYNMPSTSFVVSA----GPGPCMFAFYELTAG 395

  Fly   366 ---EFWILGDVFIGRYYTAFDAGQRRIGFA 392
               ..|:||..|:..|....|....|:|.|
 Worm   396 GFYPAWMLGPPFMRAYCHVHDMKSGRLGLA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 112/374 (30%)
Asp 80..394 CDD:278455 112/367 (31%)
hrg-7NP_001256448.1 pepsin_retropepsin_like 71..427 CDD:416259 112/367 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.