DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and asp-6

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_505133.1 Gene:asp-6 / 179209 WormBaseID:WBGene00000219 Length:389 Species:Caenorhabditis elegans


Alignment Length:336 Identity:113/336 - (33%)
Similarity:175/336 - (52%) Gaps:36/336 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNASASSTFVPDGRRFSI 142
            :.||.|.|:||:|.|.|.::.||||:|||:|...|...   |....:::::||||||.:|:.::|
 Worm    68 DFEYLGNITIGTPDQGFIVVLDTGSSNLWIPGPTCKTN---CKTKSKFDSTASSTFVKNGKSWTI 129

  Fly   143 AYGTGSLSGRLAQDTVAIG-----QLVVQNQTFGMATHEPGPTFVDTNFAGIVGLGFRPIAELGI 202
            .||:|..:|.|.||||..|     ||.|...|||:|: :....|.:....||:||.|..:|..|:
 Worm   130 QYGSGDAAGILGQDTVRFGAKGDSQLSVPTTTFGIAS-KISADFKNDATDGILGLAFTSLAVDGV 193

  Fly   203 KPLFESMCDQQLVDECVFSFYLKRNGSERK--GGELLFGGVDKTKFSGSLTYVPLTHAGYWQFPL 265
            .|...:..:|.::|:.:||.:|:..|:...  ||...:|.:|.|.....:.|.||:.|.|:||..
 Worm   194 VPPLINAINQGILDQPLFSVWLEHRGAANNVGGGVFTYGAIDTTNCGALVAYQPLSSATYYQFKA 258

  Fly   266 DVIEVAGTRINQNRQAIADTGTSLLAAPPREYLIINSLLGGLPTS--------NNEYLLNCSEID 322
            ...::......:....|:|||||.|..|       .|::.||..:        |..|.::|:...
 Worm   259 AGFKLGSYSNTKTVDVISDTGTSFLGGP-------QSVVDGLAKAAGATYDDFNEVYFIDCAAQP 316

  Fly   323 SLPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICL-SAFTLMDAEF---WILGDVFIGRYYTAFD 383
            ...:|.  ||...:.:||.:|::    |.|:..|| :||......|   |||||.||.:|...:|
 Worm   317 GTLDIT--IGTNTYSIQPVNYIV----DAGNGQCLFAAFPFDFGGFGPSWILGDPFIRQYCNIYD 375

  Fly   384 AGQRRIGFAPA 394
            .|.:|:||||:
 Worm   376 IGNKRMGFAPS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 110/332 (33%)
Asp 80..394 CDD:278455 112/332 (34%)
asp-6NP_505133.1 Asp 70..385 CDD:278455 111/331 (34%)
pepsin_like 71..385 CDD:133138 110/330 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.