DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and Ctsd

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_034113.1 Gene:Ctsd / 13033 MGIID:88562 Length:410 Species:Mus musculus


Alignment Length:394 Identity:157/394 - (39%)
Similarity:223/394 - (56%) Gaps:31/394 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LIRIPMQFQASFMASRRQHRAGRSSL--------LAKYNVVGGQEVTSRNGGATETLDNRLNLEY 81
            :||||::   .|.:.||.......|:        :.||::....:.|.   ..:|.|.|.|:.:|
Mouse    21 IIRIPLR---KFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTE---PVSELLKNYLDAQY 79

  Fly    82 AGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNASASSTFVPDGRRFSIAYGT 146
            .|.|.||:|.|.|.::|||||:||||||..|....:||..||:||:..|||:|.:|..|.|.||:
Mouse    80 YGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGS 144

  Fly   147 GSLSGRLAQDTVAI---------GQLVVQNQTFGMATHEPGPTFVDTNFAGIVGLGFRPIAELGI 202
            |||||.|:||||::         ..:.|:.|.||.||.:||..||...|.||:|:|:..|:...:
Mouse   145 GSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNV 209

  Fly   203 KPLFESMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHAGYWQFPLDV 267
            .|:|:::..|:|||:.:|||||.|:...:.||||:.||.|...:.|.|:|:.:|...|||..:|.
Mouse   210 LPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQ 274

  Fly   268 IEVAG--TRINQNRQAIADTGTSLLAAPPREYLIINSLLGGLPTSNNEYLLNCSEIDSLPEIVFI 330
            :||..  |......:||.|||||||..|..|...:...:|.:|....||::.|.::.|||.:...
Mouse   275 LEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLK 339

  Fly   331 IGGQRFGLQPRDYVMSATNDDGSSICLSAFTLMD-----AEFWILGDVFIGRYYTAFDAGQRRIG 390
            :||:.:.|.|..|::. .:..|.:||||.|..||     ...|||||||||.|||.||....|:|
Mouse   340 LGGKNYELHPDKYILK-VSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVG 403

  Fly   391 FAPA 394
            ||.|
Mouse   404 FANA 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 143/336 (43%)
Asp 80..394 CDD:278455 141/329 (43%)
CtsdNP_034113.1 A1_Propeptide 21..46 CDD:285240 8/27 (30%)
Cathepsin_D2 73..405 CDD:133157 141/332 (42%)
Asp 78..407 CDD:278455 141/329 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100536
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.