DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and LOC101735147

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_031756605.1 Gene:LOC101735147 / 101735147 -ID:- Length:337 Species:Xenopus tropicalis


Alignment Length:325 Identity:140/325 - (43%)
Similarity:196/325 - (60%) Gaps:8/325 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNASASSTFVPDGRRFS 141
            |..:|.|.|.:|:..|.|.::|||||:||||||..||...:||..||:|::|.|||:|.:|..|:
 Frog    13 LQAQYYGEIGLGTAPQNFTVVFDTGSSNLWVPSVHCSMLDIACWMHHKYDSSKSSTYVKNGTAFA 77

  Fly   142 IAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVGLGFRPIAELGIKPLF 206
            |.||||||||.|::|||.||.|.|:.|.||.|..:||.|||...|.||:|:.:..|:..|..|:|
 Frog    78 IQYGTGSLSGYLSKDTVTIGNLAVKGQIFGEAVKQPGVTFVAAKFDGILGMAYPVISVDGAPPVF 142

  Fly   207 ESMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHAGYWQFPLDVIEVA 271
            :::..|:||:..:|||||.||...:.|||||.||.|...::|...|:.:|...|||..:|.:.|.
 Frog   143 DNIMAQKLVESNIFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFHYLSVTRKAYWQIHMDQLGVG 207

  Fly   272 G--TRINQNRQAIADTGTSLLAAPPREYLIINSLLGGLPTSNNEYLLNCSEIDSLPEIVFIIGGQ 334
            .  |......:.|.||||||:..|..|...:...:|.:|....:|::.|.::.:||.|...:|||
 Frog   208 DQLTLCKGGCEVIVDTGTSLITGPLEEVTALQKAIGAVPLIQGQYMVQCDKVPTLPVISLTLGGQ 272

  Fly   335 RFGLQPRDYVMSATNDDGSSICLSAFTLMD-----AEFWILGDVFIGRYYTAFDAGQRRIGFAPA 394
            .:.|....|:|. .:..||:||||.|..::     ...|||||||||:||:.||....|:|||.|
 Frog   273 VYTLTGEQYIMK-VSQLGSTICLSGFMGLNIPPPAGPLWILGDVFIGQYYSVFDRANNRVGFAKA 336

  Fly   395  394
             Frog   337  336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 137/321 (43%)
Asp 80..394 CDD:278455 138/320 (43%)
LOC101735147XP_031756605.1 Cathepsin_D2 12..335 CDD:133157 138/322 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.