DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and LOC100489782

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_002933028.1 Gene:LOC100489782 / 100489782 -ID:- Length:383 Species:Xenopus tropicalis


Alignment Length:404 Identity:145/404 - (35%)
Similarity:218/404 - (53%) Gaps:39/404 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WLSLWILCLFWAKCQGQLIRIPMQFQASFMASRRQHRAGRSSLLAKYNVVGGQEVTSR-NGGATE 71
            :|.|.::||   :....|:|:|:....|.    ||:.| .:.:|.||......:::|| .|.|..
 Frog     3 FLILILVCL---QLSEGLVRVPLMKSKSI----RQNMA-EAGVLDKYLQTHKIDLSSRYRGYAVV 59

  Fly    72 TLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNASASSTFVPD 136
            |.....:..|.||||||:|.|.|.:||||||:||||||:.|  :|.||.:|:.:..|.|||:..:
 Frog    60 TESMYFDTYYYGPISIGTPPQNFLVLFDTGSSNLWVPSSYC--QSSACTNHNVFKPSQSSTYSSN 122

  Fly   137 GRRFSIAYGTG----SLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVGLGFRPI 197
            |::|::.||.|    |::|....|||:|..:.:.||.||:...||...|..:.|.||:||.:..:
 Frog   123 GQKFTMGYGGGNVASSVTGLFGYDTVSIQGISITNQEFGLTITEPTSNFYYSPFDGILGLAYPGL 187

  Fly   198 AELGIKPLFESMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHAGYWQ 262
            :..|.:.:.:.|..:.|::..:||.||   ||:  .||::|||||...::|.:.:.||:...|||
 Frog   188 SVEGAQTVLQGMMQENLLNPSMFSIYL---GSQ--SGEIIFGGVDSNLYTGQIYWAPLSQELYWQ 247

  Fly   263 FPLDVIEVAGTR---INQNRQAIADTGTSLLAAPPREYLIINSLLG--GLPTSNNEYLLNCSEID 322
            ..|....:.|..   .:|..|||.||||:.|.. |:.||  ..||.  |:.|.|..|.:||:.:.
 Frog   248 VALQEFSINGQATGWCSQGCQAIVDTGTTQLNI-PQTYL--TKLLPYLGIQTQNGGYYVNCNNLQ 309

  Fly   323 SLPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAFTLMD------AEFWILGDVFIGRYYTA 381
            :||.:.|.|.|..|.|.|..|::..     :..|.:.|..:.      ...|||||||:.:||:.
 Frog   310 NLPTLSFTINGVSFPLPPSAYIIQE-----NGYCYANFLNLSLPAQNGQPLWILGDVFLRQYYSV 369

  Fly   382 FDAGQRRIGFAPAA 395
            ||.|..:||||..|
 Frog   370 FDYGNNQIGFASLA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 124/335 (37%)
Asp 80..394 CDD:278455 125/328 (38%)
LOC100489782XP_002933028.1 A1_Propeptide 17..45 CDD:369623 10/32 (31%)
pepsin_retropepsin_like 66..381 CDD:386101 124/329 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.