DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and YPS6

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_012305.3 Gene:YPS6 / 854857 SGDID:S000001478 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:381 Identity:85/381 - (22%)
Similarity:148/381 - (38%) Gaps:94/381 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YYGTIAMGNPRQNFTVIFDTGSSN--------------------------------TWLPS--VN 94
            |...:.:|.|.|...:..|||||:                                ..|||  ::
Yeast    67 YVVKMEIGTPPQTLYLQLDTGSSDMIVNNADIAYCKSMSDGSDYASTDNYELTATFNGLPSTTIS 131

  Fly    95 CPMSNSACQNHRKYNSSRSSSYIPDGRNFTLRYGSG-MVVGYLSKDTMHIAGAELPHFTFGESLF 158
            ....|:.|.....:::|.||::..:...|...||.| ...|....|.:......|..||||    
Yeast   132 SEAYNTLCSYWGTFDASNSSTFENNATFFNNTYGDGTYYAGTYGTDVVSFENITLNDFTFG---- 192

  Fly   159 LQHFAFSSVKFD------GLVGLGLGVLSWS---------NTTPF------LELLCAQRLLEKCV 202
                    |..|      |::|:.|.:..::         |.|||      :||. .|..:.|..
Yeast   193 --------VSNDTIGNPSGILGISLPIAEFTDGIEYALALNRTPFIYDNFPMELK-NQGKINKIA 248

  Fly   203 FSVYLRRDPR---EIVFGGFDESKFEGKLHYVPVSQ-WHT-----------WSLQISKSSVGTKQ 252
            :|::|.....   .|:||..|:||:.|:|:.:|:.| ::|           .|:.|..|..|.|.
Yeast   249 YSLFLNGPDAHFGSILFGAVDKSKYTGQLYTLPMLQAFNTLGSNPGMIITAQSVAILDSESGNKT 313

  Fly   253 IGG-KSNAILDTGTSLVLVPQQTYHNLLNTLSAKLQN---GYFVVACKSGSLPNINILIGDKVFP 313
            :.. :...:||:||:...:|.:....:..:...:..:   || :..|...:...:::..|.  |.
Yeast   314 VSDIQFPVMLDSGTTFSYLPTEIAEAIGKSFDGEYSSDDQGY-IFDCSKVNDTLLSVDFGG--FN 375

  Fly   314 LTSSDYIMEVLLDRKPACVLAIAPINRGFWVLGDIFLRRYYTVFDATEKRIGLAKA 369
            ::::  |...:...|..|||.:.. :...::|||.||...|.|:|.....|.:|:|
Yeast   376 ISAN--ISNFVTSAKDRCVLNVKQ-SESTYMLGDAFLVDAYVVYDLENYEISIAQA 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 83/378 (22%)
Asp 63..369 CDD:278455 84/379 (22%)
YPS6NP_012305.3 SAP_like 65..428 CDD:133141 84/379 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341768
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.