DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and YPS5

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_011255.1 Gene:YPS5 / 852632 SGDID:S000003228 Length:165 Species:Saccharomyces cerevisiae


Alignment Length:66 Identity:19/66 - (28%)
Similarity:32/66 - (48%) Gaps:13/66 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 SVGTKQIGG--KSNAILDT----GTSLVLV------PQQTYHNLLNTLSA-KLQNGYFVVACKSG 298
            ::||:.:..  |.|.:|:|    |..:.:|      |.||.:..|:|.|: .:.|...:..|||.
Yeast    40 NIGTQDVSTVFKRNEVLNTTVINGIGVYVVKMEIGTPPQTVYLQLDTGSSDMIVNNADIAYCKSM 104

  Fly   299 S 299
            |
Yeast   105 S 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 19/66 (29%)
Asp 63..369 CDD:278455 19/66 (29%)
YPS5NP_011255.1 pepsin_retropepsin_like 65..>100 CDD:416259 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.