DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and AT1G49050

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_564539.1 Gene:AT1G49050 / 841328 AraportID:AT1G49050 Length:583 Species:Arabidopsis thaliana


Alignment Length:381 Identity:88/381 - (23%)
Similarity:146/381 - (38%) Gaps:92/381 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YYGTIAMGNPR--QNFTVIFDTGSSNTWL----PSVNCPMSNSACQNHRKYNSSRSSS--YIPDG 120
            ||..|.:|.|.  |.:.:..||||..||:    |..:|....:.....||.|..|||.  .:...
plant   203 YYTRILVGKPEDGQYYHLDIDTGSELTWIQCDAPCTSCAKGANQLYKPRKDNLVRSSEAFCVEVQ 267

  Fly   121 RN-------------FTLRYGS-GMVVGYLSKDTMH-------IAGAELPHFTFG-----ESLFL 159
            ||             :.:.|.. ...:|.|:||..|       :|.:::   .||     :.|.|
plant   268 RNQLTEHCENCHQCDYEIEYADHSYSMGVLTKDKFHLKLHNGSLAESDI---VFGCGYDQQGLLL 329

  Fly   160 QHFAFSSVKFDGLVGLGLGVLSWSNTTPFLELLCAQRLLEKCVFSVYLRRD--PREIVFGGFDES 222
            .    :.:|.||::||....:|       |....|.|.:...|....|..|  ....:|.|.|..
plant   330 N----TLLKTDGILGLSRAKIS-------LPSQLASRGIISNVVGHCLASDLNGEGYIFMGSDLV 383

  Fly   223 KFEGKLHYVPV---SQWHTWSLQISKSSVGTKQI------GGKSNAILDTGTSLVLVPQQTYHNL 278
            ...| :.:||:   |:...:.:|::|.|.|...:      |.....:.|||:|....|.|.|..|
plant   384 PSHG-MTWVPMLHDSRLDAYQMQVTKMSYGQGMLSLDGENGRVGKVLFDTGSSYTYFPNQAYSQL 447

  Fly   279 LNTLS---------------------AKLQNGYFVVACKSGSLPNINILIGDKVFPLT------S 316
            :.:|.                     ||....:..::........|.:.||.|...::      .
plant   448 VTSLQEVSGLELTRDDSDETLPICWRAKTNFPFSSLSDVKKFFRPITLQIGSKWLIISRKLLIQP 512

  Fly   317 SDYIMEVLLDRKPAC--VLAIAPINRGFW-VLGDIFLRRYYTVFDATEKRIGLAKA 369
            .||:  ::.::...|  :|..:.::.|.. :||||.:|.:..|:|..::|||..|:
plant   513 EDYL--IISNKGNVCLGILDGSSVHDGSTIILGDISMRGHLIVYDNVKRRIGWMKS 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 87/378 (23%)
Asp 63..369 CDD:278455 87/379 (23%)
AT1G49050NP_564539.1 nucellin_like 201..568 CDD:133142 88/381 (23%)
Asp 203..562 CDD:278455 85/375 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.