DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and bace1

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001072485.1 Gene:bace1 / 779940 XenbaseID:XB-GENE-5787150 Length:502 Species:Xenopus tropicalis


Alignment Length:431 Identity:93/431 - (21%)
Similarity:168/431 - (38%) Gaps:93/431 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLCFLLAFLSLVFATQKILKVPLYVRRSFNESEVFLARSATEGGETLQLQLL-----LQTHNNME 63
            :|..|..||.:  ..|..:|:||...........:.|:.:.|.|..|....|     |:..:...
 Frog    13 LLVLLPCFLPV--TGQVAIKLPLKNCPGTCSPMAYRAKRSAEKGMELDTNFLDMIDNLRGKSGQG 75

  Fly    64 YYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSAC--QNHRKYNSSRSSSYIPDGRNFTLR 126
            ||..:.:|.|.|...::.||||||..:.:...|......  |:.|.|...|...|:|        
 Frog    76 YYVEMRVGTPPQTLNILVDTGSSNFAVGAAPHPFLKRYYHRQHSRTYRDVRRGVYVP-------- 132

  Fly   127 YGSGMVVGYLSKDTMHI-------AGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSWSN 184
            |..|...|.|..|.:.|       ..|.:...|..:..|:     :...::|::||....::..:
 Frog   133 YTQGKWEGELGTDLVTIPHGPNVTVTANIAAITDSDKFFI-----NGSNWEGILGLAYAEIARPD 192

  Fly   185 TT--PFLELLCAQRLLEKCVFSVYL--------RRDPR-----EIVFGGFDESKFEGKLHYVPV- 233
            .|  ||.:.|..|..:.. :||:.|        ..|..     .:|.||.|.|.:.|.:.|.|: 
 Frog   193 DTLEPFFDSLVKQTRVPN-IFSLQLCGTGFHFNESDTSASVGGSMVIGGIDPSLYIGSIWYTPIR 256

  Fly   234 SQWHTWSLQISKSSVGTKQIG------GKSNAILDTGTSLVLVPQQTYHNLLNTLSA-----KLQ 287
            .:|: :.:.|.|..:..:.:.      ....:|:|:||:.:.:|::.:...:.::.|     |..
 Frog   257 KEWY-YEVIIVKIEINGQDLHMDCKEYNYDKSIVDSGTTNLRLPKRVFDAAVKSIKAASSTEKFP 320

  Fly   288 NGYF----VVACKSGSLPNINILIGDKVFPLTSSDYIM----------------------EVLLD 326
            :|::    :|..:.|:.|       ..:||:.|. |:|                      ::...
 Frog   321 DGFWLGEQLVCWQEGTTP-------WHIFPVISL-YLMGEVANQSFKITILPQQYLRPVEDIATA 377

  Fly   327 RKPACVLAIAPINRGFWVLGDIFLRRYYTVFDATEKRIGLA 367
            ::.....|::....| .|:|.:.:..:|.|||...||||.|
 Frog   378 QEDCYKFAVSQSTTG-TVMGAVIMEGFYVVFDRANKRIGFA 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 79/369 (21%)
Asp 63..369 CDD:278455 79/367 (22%)
bace1NP_001072485.1 beta_secretase_like 73..438 CDD:133140 79/369 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.