DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and ctsd

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_571785.2 Gene:ctsd / 65225 ZFINID:ZDB-GENE-010131-8 Length:398 Species:Danio rerio


Alignment Length:398 Identity:142/398 - (35%)
Similarity:215/398 - (54%) Gaps:40/398 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAFLSLVFA----TQKILKVPL----YVRRSFNESEVFLARSATE---GGETLQLQL-------- 54
            :|||.||.|    :..|:::||    .:||:.::|    .||..|   ...:|:..|        
Zfish     3 IAFLLLVVAFFCTSDAIVRIPLKKFRTLRRTLSDS----GRSLEELVSSSNSLKYNLGFPASNDP 63

  Fly    55 ---LLQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSY 116
               .|:.:.:.:|||.|.:|.|.|.|||:|||||||.|:|||:|.:::.||..|.|||..:||:|
Zfish    64 TPETLKNYLDAQYYGEIGLGTPVQTFTVVFDTGSSNLWVPSVHCSLTDIACLLHHKYNGGKSSTY 128

  Fly   117 IPDGRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLS 181
            :.:|..|.::||||.:.||||:||..|....:....|||::.....||.:.||||::|:....::
Zfish   129 VKNGTQFAIQYGSGSLSGYLSQDTCTIGDIAVEKQIFGEAIKQPGVAFIAAKFDGILGMAYPRIA 193

  Fly   182 WSNTTPFLELLCAQRLLEKCVFSVYLRRDP-----REIVFGGFDESKFEGKLHYVPVSQWHTWSL 241
            .....|..:::.:|:.:||.|||.||.|:|     .|::.||.|...:.|..:||.:|:...|.:
Zfish   194 VDGVPPVFDMMMSQKKVEKNVFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFNYVDISRQAYWQI 258

  Fly   242 QISKSSVGT--KQIGGKSNAILDTGTSLVLVPQQTYHNLLNTLSA-KLQNGYFVVACKS-GSLPN 302
            .:...|:|:  ....|...||:||||||:..|......|...:.| .|..|.::|.||. .:||.
Zfish   259 HMDGMSIGSGLSLCKGGCEAIVDTGTSLITGPAAEVKALQKAIGAIPLMQGEYMVDCKKVPTLPT 323

  Fly   303 INILIGDKVFPLTSSDYIMEVLLDRKPACV-----LAIAPINRGFWVLGDIFLRRYYTVFDATEK 362
            |:..:|.||:.||...||::........|:     |.|.|.....|:|||:|:.:||||||....
Zfish   324 ISFSLGGKVYSLTGEQYILKESQGGHDICLSGFMGLDIPPPAGPLWILGDVFIGQYYTVFDRENN 388

  Fly   363 RIGLAKAK 370
            |:|.||||
Zfish   389 RVGFAKAK 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 120/320 (38%)
Asp 63..369 CDD:278455 121/319 (38%)
ctsdNP_571785.2 A1_Propeptide 19..44 CDD:285240 8/28 (29%)
Cathepsin_D2 70..394 CDD:133157 120/323 (37%)
Asp 75..395 CDD:278455 121/319 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.