DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and asp-19

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001123079.1 Gene:asp-19 / 6418790 WormBaseID:WBGene00077655 Length:223 Species:Caenorhabditis elegans


Alignment Length:201 Identity:54/201 - (26%)
Similarity:91/201 - (45%) Gaps:46/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSN----SACQNHRKYNSSRSSSYIPDGRNFTLR 126
            |.|.:|.|.|:.:|..||.|:|.|:....|..:|    |..:.| |:|:::|:|::...|.|:..
 Worm    41 GNITIGTPPQSASVFMDTTSANWWVIGSKCTSANCNGYSGIRKH-KFNTTKSTSFVEGNRTFSTE 104

  Fly   127 YGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGV--------LSW- 182
            |  |:..|||..||:.:.|..:.....|.:.              :||||.|:        |:| 
 Worm   105 Y--GLCTGYLGTDTVQMGGLTITKQELGIAT--------------IVGLGFGLKPYVGIFELAWP 153

  Fly   183 ----SNTTPFLELLCAQRLLEKCVFSVYLRRDPRE----------IVFGGFDESKFEGKLHYVPV 233
                ...||.::.|.:|..|:..:|:::|  |.::          |.:||||....:..:.||.:
 Worm   154 ALSVDQVTPPMQKLISQNQLDAPMFTIWL--DQKDQGVYVGYTGLITYGGFDNKNCDANVTYVAL 216

  Fly   234 SQWHTW 239
            |....|
 Worm   217 SSKTFW 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 54/201 (27%)
Asp 63..369 CDD:278455 54/201 (27%)
asp-19NP_001123079.1 pepsin_like 40..>223 CDD:133138 54/201 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162043
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.