DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and mgc108380

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001027480.1 Gene:mgc108380 / 613072 -ID:- Length:384 Species:Xenopus tropicalis


Alignment Length:388 Identity:134/388 - (34%)
Similarity:206/388 - (53%) Gaps:35/388 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLAFLSLVFATQKILKVPLYVRRSFNESEVFLARS-ATEGGETLQLQLLLQTHNNME-------- 63
            :|||:.|.. ::.:::|||  :|..:..::...|. ..|..:|.:....|:.|.|.:        
 Frog     5 VLAFICLQL-SEGLVRVPL--KRYKSARDIMRERGILKEFMKTHKRDPALKYHFNEKYDFAVAYE 66

  Fly    64 -------YYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDGR 121
                   |||.|::|.|.|||.|:|||||||.|:||.:|  .:.||.||..:|.|:||:|..:|:
 Frog    67 PMYMDTYYYGEISIGTPPQNFLVLFDTGSSNLWVPSTSC--QSEACSNHNLFNPSQSSTYTSNGQ 129

  Fly   122 NFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSWSNTT 186
            .|::.||||.|.|....||:.:.|..|.:..||.:......:|...||||:.|:....:|....|
 Frog   130 QFSMSYGSGSVTGVFGYDTVTVQGLSLNNQEFGLTYTESGSSFYYSKFDGIFGMAYPAMSAGGAT 194

  Fly   187 PFLELLCAQRLLEKCVFSVYLRRDPREIVFGGFDESKFEGKLHYVPVSQWHTWSLQISKSSVGTK 251
            ..::.:..|.||...:||||:.....|::|||.|.:.:.|::.:.||:|...|.:.|.:..:..:
 Frog   195 TAMQGMLQQNLLTYPIFSVYMSSQSGEVIFGGVDNNLYSGQIQWSPVTQEVYWQIGIDEFLINGQ 259

  Fly   252 QIGGKS---NAILDTGTSLVLVPQQTYHNLLNTLSAKLQNGYFVVACKS-GSLPNINILIGDKVF 312
            ..|..|   .||:|||||.:.:|||....||..|.|:..||.|||.|.| .:||.|..:|....|
 Frog   260 ATGWCSQGCQAIVDTGTSPLTIPQQYMGTLLQNLGAQNYNGMFVVNCNSVQNLPTITFVINGVQF 324

  Fly   313 PLTSSDYIMEVLLDRKPACVLAI----APINRG--FWVLGDIFLRRYYTVFDATEKRIGLAKA 369
            |:..|.||::.    ...|.:.:    .|...|  .|:|||:|||:||:|:|.:..|:|.|:|
 Frog   325 PIPPSGYIVQT----NGYCTVGVEETYLPSQNGQPLWILGDVFLRQYYSVYDMSNNRVGFAQA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 119/331 (36%)
Asp 63..369 CDD:278455 119/330 (36%)
mgc108380NP_001027480.1 A1_Propeptide 17..45 CDD:369623 6/29 (21%)
pepsin_retropepsin_like 71..383 CDD:386101 119/317 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1428
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.