DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and REN

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_000528.1 Gene:REN / 5972 HGNCID:9958 Length:406 Species:Homo sapiens


Alignment Length:366 Identity:125/366 - (34%)
Similarity:190/366 - (51%) Gaps:24/366 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VRRSFNESEVFLARSATEGGETLQ--------LQLLLQTHNNMEYYGTIAMGNPRQNFTVIFDTG 84
            :|.|..|..|.:||...|..:.::        ..::|..:.:.:|||.|.:|.|.|.|.|:||||
Human    42 IRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTG 106

  Fly    85 SSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDGRNFTLRYGSGMVVGYLSKDTMHIAGAELP 149
            |||.|:||..|....:||..|:.:::|.||||..:|...||||.:|.|.|:||:|.:.:.|..:.
Human   107 SSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVT 171

  Fly   150 HFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSWSNTTPFLELLCAQRLLEKCVFSVYLRRDPR-- 212
            .. |||...:....|...:|||:||:|....:....||..:.:.:|.:|::.|||.|..||..  
Human   172 QM-FGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENS 235

  Fly   213 -----EIVFGGFDESKFEGKLHYVPVSQWHTWSLQISKSSVGTKQIGGKSN--AILDTGTSLVLV 270
                 :||.||.|...:||..||:.:.:...|.:|:...|||:..:..:..  |::|||.|.:..
Human   236 QSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG 300

  Fly   271 PQQTYHNLLNTLSAKLQNGYFVVACKSG-SLPNINILIGDKVFPLTSSDYIMEVLLDRKPACVLA 334
            ...:...|:..|.||.:...:||.|..| :||:|:..:|.|.:.|||:||:.:.....|..|.||
Human   301 STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLA 365

  Fly   335 -----IAPINRGFWVLGDIFLRRYYTVFDATEKRIGLAKAK 370
                 |.|.....|.||..|:|::||.||....|||.|.|:
Human   366 IHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 115/321 (36%)
Asp 63..369 CDD:278455 116/320 (36%)
RENNP_000528.1 A1_Propeptide 33..>51 CDD:311771 3/8 (38%)
renin_like 78..405 CDD:133154 117/327 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.