DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and Pga5

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_067428.2 Gene:Pga5 / 58803 MGIID:1915935 Length:387 Species:Mus musculus


Alignment Length:392 Identity:132/392 - (33%)
Similarity:202/392 - (51%) Gaps:46/392 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSLVFATQKILKVPLY----VRRSFNESEVFLARSATEGGETLQLQLLLQTHNN----------- 61
            |.||..::.::|:||.    :|.:..||:|.  :...|.....:..:||:...|           
Mouse     7 LGLVALSECLVKIPLMKIKSMRENLRESQVL--KDYLEKYPRSRAHVLLEQRRNPAVTYEPMRNY 69

  Fly    62 --MEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDGRNFT 124
              :.|.|.|::|.|.|.|.|:.|||||..|:||:.|  |:.||.:|:.:|..|||:::..||...
Mouse    70 LDLVYIGIISIGTPPQEFRVVLDTGSSVLWVPSIYC--SSPACAHHKAFNPLRSSTFLVSGRPVN 132

  Fly   125 LRYGSGMVVGYLSKDTMHIAGAELPHFTFGESL-----FLQHFAFSSVKFDGLVGLGLGVLSWSN 184
            :.||||.:.|:|:.||:.|....:....||.||     |:::     ..|||::|||...|....
Mouse   133 VAYGSGEMSGFLAYDTVRIGDLTVVAQAFGLSLEEPGIFMEY-----AVFDGILGLGYPNLGLQG 192

  Fly   185 TTPFLELLCAQRLLEKCVFSVYLRRDPRE---IVFGGFDESKFEGKLHYVPVSQWHTWSLQISKS 246
            .||..:.|..|.|:.:.:|:.||.....:   ::.||.|.|.:.|:||:||||:...|.|.:...
Mouse   193 ITPVFDNLWLQGLIPQNLFAFYLSSKDEKGSMLMLGGVDPSYYHGELHWVPVSKPSYWQLAVDSI 257

  Fly   247 SVGTKQIG--GKSNAILDTGTSLVLVPQQTYHNLLNTLSAKLQ-NGYFVVACKS-GSLPNINILI 307
            |:..:.|.  |....|:||||||:..|:.:..|:.|.:.||.. :|.:.:.|.: .:||:|...|
Mouse   258 SMNGEVIACDGGCQGIMDTGTSLLTGPRSSIVNIQNLIGAKASGDGEYFLKCDTINTLPDIVFTI 322

  Fly   308 GDKVFPLTSSDYIMEVLLDRKPACVLAIA-----PINRGFWVLGDIFLRRYYTVFDATEKRIGLA 367
            |...:|:.:|.||.:   ||...|.....     |.:...|||||:|||.|:||||....|||||
Mouse   323 GSVTYPVPASAYIRK---DRSHNCRSNFEEGMDDPSDPEMWVLGDVFLRLYFTVFDRANNRIGLA 384

  Fly   368 KA 369
            .|
Mouse   385 PA 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 117/336 (35%)
Asp 63..369 CDD:278455 117/322 (36%)
Pga5NP_067428.2 A1_Propeptide 16..44 CDD:285240 8/29 (28%)
pepsin_retropepsin_like 64..385 CDD:299705 116/330 (35%)
Asp 74..386 CDD:278455 117/321 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.