DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and Bace2

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_062390.3 Gene:Bace2 / 56175 MGIID:1860440 Length:514 Species:Mus musculus


Alignment Length:419 Identity:98/419 - (23%)
Similarity:177/419 - (42%) Gaps:99/419 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VPLYVRRSFNESEVFLARSATEG----------GETLQLQLLLQTHN------NME------YYG 66
            :||.|.|:.|.     ..||..|          |..|.|:.:..|.|      |::      ||.
Mouse    31 LPLQVARATNH-----RASAVPGLGTPELPRADGLALALEPVRATANFLAMVDNLQGDSGRGYYL 90

  Fly    67 TIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDGRNFTLRYGSGM 131
            .:.:|.|.|...::.||||||  ......|  :|....:  ::|..||:|...|.:.|::|..|.
Mouse    91 EMLIGTPPQKVQILVDTGSSN--FAVAGAP--HSYIDTY--FDSESSSTYHSKGFDVTVKYTQGS 149

  Fly   132 VVGYLSKDTMHIAGAELPHF-----TFGESLFLQHFAFSSVKFDGLVGLGLGVLS--WSNTTPFL 189
            ..|::.:|.:.|.......|     |..||   ::|....:|::|::||....|:  .|:...|.
Mouse   150 WTGFVGEDLVTIPKGFNSSFLVNIATIFES---ENFFLPGIKWNGILGLAYAALAKPSSSLETFF 211

  Fly   190 ELLCAQRLLEKCVFSVYL----------RRDPREIVFGGFDESKFEGKLHYVPVSQWHTWSLQIS 244
            :.|.||..:.. :||:.:          ..:...:|.||.:.|.::|.:.|.|:.:...:.::|.
Mouse   212 DSLVAQAKIPD-IFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEIL 275

  Fly   245 KSSVGTKQIG------GKSNAILDTGTSLVLVPQQTYHNLL-----NTLSAKLQNGYFV---VAC 295
            |..:|.:.:.      ....||:|:||:|:.:||:.:..::     .:|..:..:|::.   :||
Mouse   276 KLEIGGQNLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARTSLIPEFSDGFWTGAQLAC 340

  Fly   296 KSGS------LPNINILIGDKVFPLTSSDYIMEVLLDRKPACVLAIAP-INRGF----------- 342
            .:.|      .|.|:|.:.|:   ..|..:.:.:|..      |.|.| :..||           
Mouse   341 WTNSETPWAYFPKISIYLRDE---NASRSFRITILPQ------LYIQPMMGAGFNYECYRFGISS 396

  Fly   343 ----WVLGDIFLRRYYTVFDATEKRIGLA 367
                .|:|...:..:|.|||..::|:|.|
Mouse   397 STNALVIGATVMEGFYVVFDRAQRRVGFA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 85/366 (23%)
Asp 63..369 CDD:278455 84/364 (23%)
Bace2NP_062390.3 beta_secretase_like 85..446 CDD:133140 84/360 (23%)
Asp 88..425 CDD:278455 83/355 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.