DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and PGA5

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_055039.1 Gene:PGA5 / 5222 HGNCID:8887 Length:388 Species:Homo sapiens


Alignment Length:403 Identity:135/403 - (33%)
Similarity:204/403 - (50%) Gaps:65/403 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAFLSLVFATQKIL-KVPLYVRRSFNESEVFLARSATEGGETLQLQLLLQTHN------------ 60
            |..|.||..::.|: ||||..::|       |.|:.:|.|   .|:..|:.||            
Human     4 LLLLGLVALSECIMYKVPLIRKKS-------LRRTLSERG---LLKDFLKKHNLNPARKYFPQWE 58

  Fly    61 --------------NMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSS 111
                          :|||:|||.:|.|.|:|||:|||||||.|:|||.|  |:.||.||.::|..
Human    59 APTLVDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYC--SSLACTNHNRFNPE 121

  Fly   112 RSSSYIPDGRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGES-----LFLQHFAFSSVKFDG 171
            .||:|.......::.||:|.:.|.|..||:.:.|....:..||.|     .||.:     ..|||
Human   122 DSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYY-----APFDG 181

  Fly   172 LVGLGLGVLSWSNTTPFLELLCAQRLLEKCVFSVYLRRDPRE---IVFGGFDESKFEGKLHYVPV 233
            ::||....:|.|..||..:.:..|.|:.:.:|||||..|.:.   ::|||.|.|.:.|.|::|||
Human   182 ILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPV 246

  Fly   234 SQWHTWSLQISKSSVGTKQIGGKS--NAILDTGTSLVLVPQQTYHNLLNTLSA-KLQNGYFVVAC 295
            :....|.:.:...::..:.|....  .||:||||||:..|.....|:.:.:.| :..:|..||:|
Human   247 TVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSC 311

  Fly   296 KS-GSLPNINILIGDKVFPLTSSDYIMEVLLDRKPACVLAI----APINRG-FWVLGDIFLRRYY 354
            .: .|||:|...|....:|:..|.||    |..:.:|:...    .|...| .|:|||:|:|:|:
Human   312 SAISSLPDIVFTINGVQYPVPPSAYI----LQSEGSCISGFQGMNVPTESGELWILGDVFIRQYF 372

  Fly   355 TVFDATEKRIGLA 367
            ||||....::|||
Human   373 TVFDRANNQVGLA 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 117/324 (36%)
Asp 63..369 CDD:278455 116/322 (36%)
PGA5NP_055039.1 A1_Propeptide 17..45 CDD:285240 11/37 (30%)
pepsin_A 66..386 CDD:133145 117/331 (35%)
Asp 75..387 CDD:278455 116/322 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1428
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.