DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and pga4

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_002942158.1 Gene:pga4 / 496914 XenbaseID:XB-GENE-979768 Length:384 Species:Xenopus tropicalis


Alignment Length:399 Identity:128/399 - (32%)
Similarity:206/399 - (51%) Gaps:59/399 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLAFLSLVFATQKILKVPLYVRRSFNE--------------------SEVF--LARSATEGGETL 50
            ||..|.||..::.::||||....||..                    |:.|  ||:|:.|     
 Frog     3 LLLLLGLVVLSECVVKVPLRKGESFRNRLQRLGLLGDYLKKYPYNPASKYFPTLAQSSAE----- 62

  Fly    51 QLQLLLQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSS 115
                :||.:.::||||||::|.|.|.|||||||||:|.|:|||.|  |:|||.||.::|..:|::
 Frog    63 ----VLQNYMDIEYYGTISIGTPPQEFTVIFDTGSANLWVPSVYC--SSSACTNHNRFNPQQSTT 121

  Fly   116 YIPDGRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGES-----LFLQHFAFSSVKFDGLVGL 175
            :.......:::||:|.:.|:|..||:.:...::.:..||.|     .||.:     ..|||::||
 Frog   122 FQATNTPVSIQYGTGSMSGFLGYDTLQVGNIKISNQMFGLSESEPGSFLYY-----SPFDGILGL 181

  Fly   176 GLGVLSWSNTTPFLELLCAQRLLEKCVFSVYLRRDPRE---IVFGGFDESKFEGKLHYVPVSQWH 237
            ....::.|..||..:.:.:|.|:.:.:|||||..|.:.   ::|||.|.|.:.|.|::||::...
 Frog   182 AFPSIASSQATPVFDNMWSQGLIPQNLFSVYLSSDGQSGSYVLFGGVDTSYYSGSLNWVPLTAET 246

  Fly   238 TWSLQISKSSVGTKQIGGKSN--AILDTGTSLVLVPQQTYHNLLNTLSAKL-QNGYFVVACKS-G 298
            .|.:.:...|:..:.|....:  ||:||||||:..|.....|:...:.|.. .||.:|:.|.: .
 Frog   247 YWQIILDSISINGQVIACSQSCQAIVDTGTSLMTGPTTPIANIQYYIGASQDSNGQYVINCNNIS 311

  Fly   299 SLPNINILIGDKVFPLTSSDYIMEVLLDRKPACVLAI----APINRG-FWVLGDIFLRRYYTVFD 358
            ::|.|...|....:||..:.|:.:    .:..|....    .|.|.| .|:|||:|:|:|:.|||
 Frog   312 NMPTIVFTINGVQYPLPPTAYVRQ----NQQGCSSGFQAMTLPTNSGDLWILGDVFIRQYFVVFD 372

  Fly   359 ATEKRIGLA 367
            .|...:.:|
 Frog   373 RTNNYVAMA 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 109/324 (34%)
Asp 63..369 CDD:278455 109/322 (34%)
pga4XP_002942158.1 A1_Propeptide 16..44 CDD:369623 6/27 (22%)
pepsin_A 62..382 CDD:133145 112/340 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.