DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and napsa

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001005701.1 Gene:napsa / 448214 XenbaseID:XB-GENE-947098 Length:402 Species:Xenopus tropicalis


Alignment Length:388 Identity:136/388 - (35%)
Similarity:213/388 - (54%) Gaps:30/388 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLLAFLSLVFATQKILKVPL----YVRRSFNES---EVFLARSATEGGETLQLQLL---LQTHNN 61
            |:|  |.||:.|..::::||    .:||:.::|   |.|  ..||:  |.|:.|.:   |..:.:
 Frog     6 FIL--LLLVWTTDALIRIPLKKFPSIRRTLSDSMTKEEF--NGATK--EFLKQQTIPEKLTNYLD 64

  Fly    62 MEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDGRNFTLR 126
            .:|||.|.:|.|.|.|.|||||||||.|:||:.|...:.||..|:||.|..||:|..:...|.::
 Frog    65 AQYYGEIFIGTPPQKFAVIFDTGSSNLWVPSIKCSFFDFACWLHKKYRSKDSSTYQQNNTEFAIQ 129

  Fly   127 YGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSWSNTTPFLEL 191
            ||:|.:.|:||:||:.:...::.:.||.|::......|....|||::|:|...:|.....|..:.
 Frog   130 YGTGSLSGFLSQDTVTVGSIDVANQTFAEAVKQPGIVFVFAHFDGILGMGYPNISVDGVVPVFDN 194

  Fly   192 LCAQRLLEKCVFSVYLRRDPR-----EIVFGGFDESKFEGKLHYVPVSQWHTWSLQISKSSVGTK 251
            :..|:|||:.|||.||.|||.     |:|.||.|.:.:.|..||:.|::...|.::..:..|..:
 Frog   195 MMEQKLLEENVFSFYLSRDPMAMVGGELVLGGTDPNYYTGDFHYLNVTRMAYWQIKADEVRVANQ 259

  Fly   252 QI--GGKSNAILDTGTSLVLVPQQTYHNLLNTLSA-KLQNGYFVVACKS-GSLPNINILIGDKVF 312
            .:  .|...||:||||||:..|::....|...:.| .|.:|.:.|.||. .|||.::.::|...:
 Frog   260 LVLCKGGCQAIVDTGTSLITGPREEIRALHKAIGAFPLFSGEYFVNCKRIQSLPTVSFILGGVAY 324

  Fly   313 PLTSSDYIMEVLLDRKPACV-----LAIAPINRGFWVLGDIFLRRYYTVFDATEKRIGLAKAK 370
            .||...|::::.......|:     |.|.|.....|:|||:|:.:||||||....|:|.|.||
 Frog   325 NLTGEQYVLKISKFGHTLCLSGFMGLDIRPPAGPLWILGDVFIGQYYTVFDRDNDRVGFATAK 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 114/320 (36%)
Asp 63..369 CDD:278455 115/319 (36%)
napsaNP_001005701.1 A1_Propeptide 18..42 CDD:369623 6/23 (26%)
pepsin_retropepsin_like 61..384 CDD:386101 114/322 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.