DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and ctsd

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_988964.1 Gene:ctsd / 394561 XenbaseID:XB-GENE-5906945 Length:398 Species:Xenopus tropicalis


Alignment Length:397 Identity:134/397 - (33%)
Similarity:211/397 - (53%) Gaps:41/397 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLAFLSLVFATQKILKVPL----YVRRSFNESE----------------VFLARSATEGGETLQL 52
            |||...::.....::::||    .:||:.:|::                .|| .|.....|||..
 Frog     9 LLALCCVMQPGSSLVRIPLKKFTSIRRAMSETDQDALKLSGNEAATKYSAFL-NSKNPTPETLLN 72

  Fly    53 QLLLQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYI 117
            .|      :.:|||.|.:|.|.|.|||:|||||||.|:||::|...:.||..|.||:||:|::||
 Frog    73 YL------DAQYYGEIGIGTPPQPFTVVFDTGSSNLWVPSIHCSFWDLACWLHHKYDSSKSTTYI 131

  Fly   118 PDGRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSW 182
            .:|..|.::||||.:.|||||||:.|....:....|.|::......|.:.||||::|:|...:|.
 Frog   132 NNGTEFAIQYGSGSLTGYLSKDTVTIGDLAVNGQFFAEAIKQPGITFVAAKFDGILGMGYPKISV 196

  Fly   183 SNTTPFLELLCAQRLLEKCVFSVYLRRDP-----REIVFGGFDESKFEGKLHYVPVSQWHTWSLQ 242
            ....|..:.:..|:|::..:||.||.|:|     .|::.||.|.:.:.|..:|:.|::...|.:.
 Frog   197 DGVPPVFDDIMEQKLVDSNIFSFYLNRNPDTLPGGELLLGGTDPAFYTGDFNYMNVTRKAYWQIH 261

  Fly   243 ISKSSVGTKQIGGKS--NAILDTGTSLVLVPQQTYHNLLNTLSA-KLQNGYFVVACKS-GSLPNI 303
            :.:.|||.:....|.  .||:||||||:..|.:....|...:.| .|..|.:::.|.| .|||.|
 Frog   262 MDQLSVGDRLSLCKDGCEAIVDTGTSLITGPVEEVTALQRAIGAIPLICGEYMILCDSIPSLPVI 326

  Fly   304 NILIGDKVFPLTSSDYIMEVLLDRKPACV-----LAIAPINRGFWVLGDIFLRRYYTVFDATEKR 363
            :...|.:.:.||...|::::....:..|:     |.|.|.....|::||:|:.:||||||....|
 Frog   327 SFTFGGRAYSLTGEQYVLKISKAGRTVCLSGFLGLDIPPPAGPLWIIGDVFIGQYYTVFDRANDR 391

  Fly   364 IGLAKAK 370
            :|.||||
 Frog   392 VGFAKAK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 115/320 (36%)
Asp 63..369 CDD:278455 116/319 (36%)
ctsdNP_988964.1 A1_Propeptide 22..>39 CDD:311771 4/16 (25%)
pepsin_retropepsin_like 72..396 CDD:325019 116/329 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.