DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and CG17134

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster


Alignment Length:393 Identity:144/393 - (36%)
Similarity:211/393 - (53%) Gaps:32/393 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRVLCFLLAFLSLVFATQKILKVPLYVRRSFNESE--------------VFLAR---SATEGGET 49
            :|.|..||..:.:..:..|:.:|.|.|.::|.::.              .|||.   |.:..|.|
  Fly     1 MRQLLVLLVLVGIGHSAAKLNRVQLQVNKNFTKTHGSVKAEKTVLASKYSFLAETSFSVSSSGAT 65

  Fly    50 LQLQLLLQTHNNM--EYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSR 112
            ..|      ||:|  ||||.||:|.|.|.|.::|||||:|.|:||.:||.||:|||.|.||:||.
  Fly    66 ENL------HNSMNNEYYGVIAIGTPEQRFNILFDTGSANLWVPSASCPASNTACQRHNKYDSSA 124

  Fly   113 SSSYIPDGRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGL 177
            ||:|:.:|..|.:.||:|.:.|:||.|.:.|||..:.:.||||:|......|....|.|::||..
  Fly   125 SSTYVANGEEFAIEYGTGSLSGFLSNDIVTIAGISIQNQTFGEALSEPGTTFVDAPFAGILGLAF 189

  Fly   178 GVLSWSNTTPFLELLCAQRLLEKCVFSVYLRRDPR-----EIVFGGFDESKFEGKLHYVPVSQWH 237
            ..::....||..:.:.:|.||::.|.|.||:|...     |::.||.|.|.:.|.|.|||||...
  Fly   190 SAIAVDGVTPPFDNMISQGLLDEPVISFYLKRQGTAVRGGELILGGIDSSLYRGSLTYVPVSVPA 254

  Fly   238 TWSLQISKSSVGTKQIGGKSNAILDTGTSLVLVPQQTYHNLLNTLSAKLQNGYFVVAC-KSGSLP 301
            .|..:::........:.....||.||||||:.||...|..:...|.|...:|...|.| :..|||
  Fly   255 YWQFKVNTIKTNGTLLCNGCQAIADTGTSLIAVPLAAYRKINRQLGATDNDGEAFVRCGRVSSLP 319

  Fly   302 NINILIGDKVFPLTSSDYIMEVLLDRKPACVLAIAPI-NRGFWVLGDIFLRRYYTVFDATEKRIG 365
            .:|:.||..||.|...|||::|..:.:..|:.|...: ...||:|||:|:.::|||||...:|||
  Fly   320 KVNLNIGGTVFTLAPRDYIVKVTQNGQTYCMSAFTYMEGLSFWILGDVFIGKFYTVFDKGNERIG 384

  Fly   366 LAK 368
            .|:
  Fly   385 FAR 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 125/315 (40%)
Asp 63..369 CDD:278455 125/313 (40%)
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 126/315 (40%)
Asp 75..388 CDD:278455 125/313 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455543
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.