DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and CG6508

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster


Alignment Length:396 Identity:146/396 - (36%)
Similarity:211/396 - (53%) Gaps:57/396 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KILKVPLY---------------VRRSFNESE----------VFLARSATEGGETLQLQLLLQTH 59
            :::.:||:               :.|..|:::          :..|:......::.|...:|...
  Fly     5 QLIIIPLFLLLLDHSMGQLRRTPITRQINQNKTHANVKAEKILLAAKYFLVDRQSSQTTQVLANG 69

  Fly    60 NNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDGRNFT 124
            .|:||...:.:|.|.|.|.:.||||||:.|:|||.|..:|.|||.|.|||||.|||::.||:.|:
  Fly    70 FNLEYTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNSSASSSHVEDGKGFS 134

  Fly   125 LRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSWSNTTPFL 189
            ::||||.:.|:||.||:.|.|..:.:.||.|::.....||.:..|||::|:....:|...|||| 
  Fly   135 IQYGSGSLSGFLSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAFASISGGVTTPF- 198

  Fly   190 ELLCAQRLLEKCVFSVYLRRDPR-----EIVFGGFDESKFEGKLHYVPVSQWHTWSLQISKSSV- 248
            :.:..|.|::..|||||||||..     |:::||.|.|.:.|.::|||||....|  |.:.:|| 
  Fly   199 DNIIRQGLVKHPVFSVYLRRDGTSQSGGEVIWGGIDRSIYRGCINYVPVSMPAYW--QFTANSVK 261

  Fly   249 --GTKQIGGKSNAILDTGTSLVLVPQQTY---HNLLNTLSAKLQNGYFVVACKS-GSLPNINILI 307
              |.....| ..||.||||||:.||.:.|   :.:||...|  .:|...|.|.| ..|||:|:.|
  Fly   262 IEGILLCNG-CQAIADTGTSLIAVPLRAYKAINKVLNATDA--GDGEAFVDCSSLCRLPNVNLNI 323

  Fly   308 GDKVFPLTSSDYIMEVLLDRKPACVLAIAPINRGF--------WVLGDIFLRRYYTVFDATEKRI 364
            |...:.||..|||.:|..|......|:      ||        |:||||||.:.|||||..::||
  Fly   324 GGTTYTLTPKDYIYKVQADNNQTLCLS------GFTYLQGNLLWILGDIFLGKVYTVFDVGKERI 382

  Fly   365 GLAKAK 370
            |.||.|
  Fly   383 GFAKLK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 136/326 (42%)
Asp 63..369 CDD:278455 136/325 (42%)
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 136/329 (41%)
Asp 73..387 CDD:278455 136/325 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455559
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.