DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and CG31661

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster


Alignment Length:413 Identity:109/413 - (26%)
Similarity:191/413 - (46%) Gaps:68/413 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRVLCFLLAFLSLVFATQKIL-------------KVP-----LYVRRSFNESEVF-------LAR 41
            :||:  :|.|..:||...|.:             |:|     |..|.:......|       ...
  Fly     3 IRVI--ILLFCLIVFVGGKKVHRFRLERRSHRHHKIPHAHLHLQFRNALRRKYGFTPLRTVNAVN 65

  Fly    42 SATEGGETLQLQLLLQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHR 106
            ..:|.|:.:.:...|....:..::|.:::|:  |:||:.||||||:.|:||.:|......|.| :
  Fly    66 VTSESGKGVVITEPLINSYDTNFFGVVSVGD--QSFTMQFDTGSSDFWVPSSHCRFCIKTCGN-K 127

  Fly   107 KYNSSRSSSYIPDGRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDG 171
            .:..|.|.|:...|..|::.||||.|.|.::.|.:.....::.:    :.:.|.:.:.|...|||
  Fly   128 FFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQN----QGIGLVNISDSCSVFDG 188

  Fly   172 LVGLGLGVLSWSNTTPFLELLCAQRLLEKCVFSVYLR---RDPREIVFGGFDESKFEGKLHYVPV 233
            :.|.....||.:.:.|..:.:..|:|:|:.:||.:|:   .|...::.||.:.|.:.|.|.|..|
  Fly   189 IAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSGSSDGGSMILGGSNSSLYYGPLTYTNV 253

  Fly   234 SQWHTWSLQISKSSVGTKQIGGKSN-----AILDTGTSLVLVPQQTYHNLLNTLSAKLQNGY--F 291
            ::...||.::...:|..|  |.:|:     ||:||||||::.|......:...:.|:....|  :
  Fly   254 TEAKYWSFKLDFIAVHGK--GSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEHNKTYNLY 316

  Fly   292 VVACKSGSLPNINILIGDKVFPLTSSDYIMEVLLDRKP---------ACVLAIAP-INRGFWVLG 346
            .|||:  |:|.:.|:    ||.:...::.:      ||         .|..|... :...:|:||
  Fly   317 TVACE--SIPQLPII----VFGIAGKEFFV------KPHTYVIRYDNFCFSAFMDMLGLQYWILG 369

  Fly   347 DIFLRRYYTVFDATEKRIGLAKA 369
            |.|:|..|..||...:|:|:|.|
  Fly   370 DAFMRENYVEFDWARRRMGIAPA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 92/326 (28%)
Asp 63..369 CDD:278455 93/325 (29%)
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 93/333 (28%)
Asp 88..392 CDD:278455 93/324 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439946
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.