DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and Bace1

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_062077.1 Gene:Bace1 / 29392 RGDID:2191 Length:501 Species:Rattus norvegicus


Alignment Length:377 Identity:82/377 - (21%)
Similarity:151/377 - (40%) Gaps:92/377 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDG 120
            |:..:...||..:.:|:|.|...::.||||||..:.:...|..      ||.|....||:|....
  Rat    67 LRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFL------HRYYQRQLSSTYRDLR 125

  Fly   121 RNFTLRYGSGMVVGYLSKDTMHI-------AGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLG 178
            ::..:.|..|...|.|..|.:.|       ..|.:...|..:..|:     :...::|::||...
  Rat   126 KSVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFI-----NGSNWEGILGLAYA 185

  Fly   179 VLSWSNTT--PFLELLCAQRLLEKCVFSVY-------------LRRDPREIVFGGFDESKFEGKL 228
            .::..:.:  ||.:.|..|..:.. :||:.             |......::.||.|.|.:.|.|
  Rat   186 EIARPDDSLEPFFDSLVKQTHIPN-IFSLQLCGAGFPLNQTEALASVGGSMIIGGIDHSLYTGSL 249

  Fly   229 HYVPVSQWHTWSLQISKSSVGTKQIGGK-----------SNAILDTGTSLVLVPQQTYHNLLNTL 282
            .|.|:.:  .|..::....|   :|.|:           ..:|:|:||:.:.:|::.:...:.::
  Rat   250 WYTPIRR--EWYYEVIIVRV---EINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSI 309

  Fly   283 SA-----KLQNGYF----VVACKSGSLP-NINILIGDKVFPLTSSDYIM---------------- 321
            .|     |..:|::    :|..::|:.| ||        ||:.|. |:|                
  Rat   310 KAASSTEKFPDGFWLGEQLVCWQAGTTPWNI--------FPVISL-YLMGEVTNQSFRITILPQQ 365

  Fly   322 ------EVLLDRKPACVLAIAPINRGFWVLGDIFLRRYYTVFDATEKRIGLA 367
                  :|...:......|::..:.| .|:|.:.:..:|.|||...||||.|
  Rat   366 YLRPVEDVATSQDDCYKFAVSQSSTG-TVMGAVIMEGFYVVFDRARKRIGFA 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 81/372 (22%)
Asp 63..369 CDD:278455 81/370 (22%)
Bace1NP_062077.1 beta_secretase_like 72..437 CDD:133140 81/372 (22%)
Interaction with RTN3. /evidence=ECO:0000250 479..501
DXXLL. /evidence=ECO:0000250|UniProtKB:P56817 496..500
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.