DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and Bace2

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001002802.1 Gene:Bace2 / 288227 RGDID:1303241 Length:514 Species:Rattus norvegicus


Alignment Length:365 Identity:86/365 - (23%)
Similarity:159/365 - (43%) Gaps:72/365 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDG 120
            ||..:...||..:.:|.|.|...::.||||||  ......|  :|....:  ::|..||:|...|
  Rat    80 LQGDSGRGYYLEMLIGTPPQKVRILVDTGSSN--FAVAGAP--HSYIDTY--FDSESSSTYHSKG 138

  Fly   121 RNFTLRYGSGMVVGYLSKDTMHIAGAELPHF-----TFGESLFLQHFAFSSVKFDGLVGLGLGVL 180
            ...|::|..|...|::.:|.:.|.......|     |..||   ::|....:|::|::||....|
  Rat   139 FEVTVKYTQGSWTGFVGEDLVTIPKGFNSSFLVNIATIFES---ENFFLPGIKWNGILGLAYAAL 200

  Fly   181 S--WSNTTPFLELLCAQRLLEKCVFSVYL----------RRDPREIVFGGFDESKFEGKLHYVPV 233
            :  .|:...|.:.|.||..:.. :||:.:          ..:...:|.||.:.|.::|.:.|.|:
  Rat   201 AKPSSSLETFFDSLVAQAKIPD-IFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPI 264

  Fly   234 SQWHTWSLQISKSSVGTKQIG------GKSNAILDTGTSLVLVPQQTYHNLL-----NTLSAKLQ 287
            .:...:.::|.|..:|.:.:.      ....||:|:||:|:.:||:.:..::     .:|..:..
  Rat   265 KEEWYYQIEILKLEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARTSLIPEFS 329

  Fly   288 NGYFV---VACKSGS------LPNINILIGDKVFPLTSSDYIMEVLLDRKPACVLAIAP-INRGF 342
            :|::.   :||.:.|      .|.|:|.:.|:   ..|..:.:.:|..      |.|.| :..||
  Rat   330 DGFWTGAQLACWTNSETPWAYFPKISIYLRDE---NASRSFRITILPQ------LYIQPMMGAGF 385

  Fly   343 ---------------WVLGDIFLRRYYTVFDATEKRIGLA 367
                           .|:|...:..:|.|||..::|:|.|
  Rat   386 NYECYRFGISSSTNALVIGATVMEGFYVVFDRAQRRVGFA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 84/360 (23%)
Asp 63..369 CDD:278455 84/358 (23%)
Bace2NP_001002802.1 beta_secretase_like 85..446 CDD:133140 84/360 (23%)
Asp 88..425 CDD:278455 83/355 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.