DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and Pgc

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_579818.1 Gene:Pgc / 24864 RGDID:3943 Length:392 Species:Rattus norvegicus


Alignment Length:391 Identity:127/391 - (32%)
Similarity:209/391 - (53%) Gaps:37/391 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLAFLSLVFATQKILKVPLYVRRSFNES-------EVFLARSATEGGETLQL------QLLLQ-- 57
            ::|.|.|......:|:|||...:|..|:       :.||.....:.|:....      .:|.:  
  Rat     5 VVALLCLPLLEASLLRVPLRKMKSIRETMKEQGVLKDFLKTHKYDPGQKYHFGNFGDYSVLYEPM 69

  Fly    58 THNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDGRN 122
            .:.:..|:|.|::|.|.|||.|:|||||||.|:.||.|  .:.||..|.::|.|:||:|..:|:.
  Rat    70 AYMDASYFGEISIGTPPQNFLVLFDTGSSNLWVSSVYC--QSEACTTHARFNPSKSSTYYTEGQT 132

  Fly   123 FTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSWSNTTP 187
            |:|:||:|.:.|:...||:.:...::|:..||.|.......|...:|||::||....||....|.
  Rat   133 FSLQYGTGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPGLSSGGATT 197

  Fly   188 FLELLCAQRLLEKCVFSVYL----RRDPREIVFGGFDESKFEGKLHYVPVSQWHTWSLQISKSSV 248
            .|:.:..:..|.:.:|.|||    ..:..:|||||.|::.:.|::.:|||:|...|.:.|....:
  Rat   198 ALQGMLGEGALSQPLFGVYLGSQQGSNGGQIVFGGVDKNLYTGEITWVPVTQELYWQITIDDFLI 262

  Fly   249 GTKQIGGKSN----AILDTGTSLVLVPQQTYHNLLNTLSAKL-QNGYFVVACKS-GSLPNINILI 307
            |.:..|..|:    .|:||||||:::|.|....||.|:.|:. :.|.:.|:|.| .|||.::.::
  Rat   263 GDQASGWCSSQGCQGIVDTGTSLLVMPAQYLSELLQTIGAQEGEYGEYFVSCDSVSSLPTLSFVL 327

  Fly   308 GDKVFPLTSSDYIMEVLLDRKPACVLAIAPIN------RGFWVLGDIFLRRYYTVFDATEKRIGL 366
            ....|||:.|.||::    ....|::.:..|:      :..|:|||:|||.||.:||....::||
  Rat   328 NGVQFPLSPSSYIIQ----EDNFCMVGLESISLTSESGQPLWILGDVFLRSYYAIFDMGNNKVGL 388

  Fly   367 A 367
            |
  Rat   389 A 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 114/323 (35%)
Asp 63..369 CDD:278455 114/321 (36%)
PgcNP_579818.1 A1_Propeptide 18..46 CDD:400357 8/27 (30%)
pepsin_retropepsin_like 73..391 CDD:416259 114/323 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.