DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and Cym

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001104613.1 Gene:Cym / 229697 MGIID:2684977 Length:379 Species:Mus musculus


Alignment Length:392 Identity:117/392 - (29%)
Similarity:203/392 - (51%) Gaps:38/392 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRVLCFLLAFLSLVFATQKILKVPLYVRRSFNES-------EVFLARSATEGGE-TLQLQLL--- 55
            :|....|||.|: :..:..:.::||:..:|...:       |.||:|...|..| ..::.::   
Mouse     1 MRRFVLLLAALA-ISQSHVVTRIPLHKGKSLRNTLKEQGLLEDFLSRQQYEFSEKNSRIGVVASE 64

  Fly    56 -LQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPD 119
             |..:.:.||:|||.:|.|.|.|||:||||||..|:|||.|  ::..|:||.:::.|:|.::...
Mouse    65 PLINYLDSEYFGTIYIGTPPQEFTVVFDTGSSELWVPSVYC--NSKVCRNHHRFDPSKSITFQNL 127

  Fly   120 GRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSWSN 184
            .:...::||:|.:.|:|:.||:.::...:.|.|.|.|.......|:...|||::||.....:...
Mouse   128 SKPLFVQYGTGRMEGFLAYDTVTVSDIVVSHQTVGLSTQEPGDIFTYSPFDGILGLAYPTFASKY 192

  Fly   185 TTPFLELLCAQRLLEKCVFSVYLRRDPR--EIVFGGFDESKFEGKLHYVPVSQWHTWSLQISKSS 247
            :.|..:.:..:.|:.:.:||||:.|:.:  .:..|..|:|.|.|.||:|||:....|...:.:.:
Mouse   193 SVPIFDNMMNRHLVAQDLFSVYMSRNEQGSMLTLGAIDQSYFIGSLHWVPVTVQGYWQFTVDRIT 257

  Fly   248 VGTKQIG--GKSNAILDTGTSLVLVPQQTYHNLLNTLSA-KLQNGYFVVAC-KSGSLPNINILIG 308
            :..:.:.  |...|:|||||:|:..|.:...|:...:.| :..|..|.:.| :...:|.:...|.
Mouse   258 INGEVVACQGGCPAVLDTGTALLTGPGRDILNIQQVIGAVQGHNDQFDIDCWRLDIMPTVVFEIH 322

  Fly   309 DKVFPLTSSDYIMEVLLDRKPACVLAIAPINRGF------WVLGDIFLRRYYTVFDATEKRIGLA 367
            .:.|||....|..:|    :..|       :.||      |:|||:|:|.:|:|||....|:|||
Mouse   323 GREFPLPPYAYTNQV----QGFC-------SSGFKQGSHMWILGDVFIREFYSVFDRANNRVGLA 376

  Fly   368 KA 369
            ||
Mouse   377 KA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 99/318 (31%)
Asp 63..369 CDD:278455 100/317 (32%)
CymNP_001104613.1 A1_Propeptide 19..44 CDD:285240 4/24 (17%)
pepsin_retropepsin_like 64..377 CDD:299705 100/325 (31%)
Asp 73..378 CDD:278455 100/317 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.