DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and Ren2

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_112470.2 Gene:Ren2 / 19702 MGIID:97899 Length:424 Species:Mus musculus


Alignment Length:350 Identity:126/350 - (36%)
Similarity:194/350 - (55%) Gaps:17/350 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ESEVFLARSATEGGETLQLQLLLQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMS 98
            |.:||..||:.   ..|...::|..:.|.:|||.|.:|.|.|.|.|||||||:|.|:||..|...
Mouse    79 EWDVFTKRSSL---TDLISPVVLTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRL 140

  Fly    99 NSACQNHRKYNSSRSSSYIPDGRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFA 163
            ..||..|..|.||.||||:.:|.:||:.||||.|.|:||:|::.:.|..:.. ||||...|....
Mouse   141 YLACGIHSLYESSDSSSYMENGDDFTIHYGSGRVKGFLSQDSVTVGGITVTQ-TFGEVTELPLIP 204

  Fly   164 FSSVKFDGLVGLGLGVLSWSNTTPFLELLCAQRLLEKCVFSVYLRRDPR----EIVFGGFDESKF 224
            |...:|||::|:|....:....||..:.:.:|.:|::.|||||..|.|.    |:|.||.|...:
Mouse   205 FMLAQFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEKVFSVYYNRGPHLLGGEVVLGGSDPEHY 269

  Fly   225 EGKLHYVPVSQWHTWSLQISKSSVGTKQIGGKS--NAILDTGTSLVLVPQQTYHNLLNTLSAKLQ 287
            :|..|||.:|:..:|.:.:...|||:..:..:.  ..::|||:|.:..|..:...::..|.||.:
Mouse   270 QGDFHYVSLSKTDSWQITMKGVSVGSSTLLCEEGCEVVVDTGSSFISAPTSSLKLIMQALGAKEK 334

  Fly   288 NGY-FVVACKS-GSLPNINILIGDKVFPLTSSDYIMEVLLDRKPACVLA-----IAPINRGFWVL 345
            ..: :||:|.. .:||:|:..:|.:.:.|:|:||:::....|...|.:|     |.|.....|||
Mouse   335 RLHEYVVSCSQVPTLPDISFNLGGRAYTLSSTDYVLQYPNRRDKLCTVALHAMDIPPPTGPVWVL 399

  Fly   346 GDIFLRRYYTVFDATEKRIGLAKAK 370
            |..|:|::||.||....|||.|.|:
Mouse   400 GATFIRKFYTEFDRHNNRIGFALAR 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 117/319 (37%)
Asp 63..369 CDD:278455 117/318 (37%)
Ren2NP_112470.2 A1_Propeptide 51..76 CDD:285240
renin_like 98..423 CDD:133154 119/325 (37%)
Asp 105..423 CDD:278455 117/318 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.