DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and Ren1

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_112469.1 Gene:Ren1 / 19701 MGIID:97898 Length:402 Species:Mus musculus


Alignment Length:383 Identity:134/383 - (34%)
Similarity:200/383 - (52%) Gaps:26/383 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SLVFATQKILKVPL----YVRRSFNESEVFLARSATEGG--------ETLQLQLLLQTHNNMEYY 65
            ||...|....::||    .||....|..|.:.|.:.|.|        ..|...::|..:.|.:||
Mouse    21 SLPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYY 85

  Fly    66 GTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDGRNFTLRYGSG 130
            |.|.:|.|.|.|.|||||||:|.|:||..|.....||..|..|.||.||||:.:|.:||:.||||
Mouse    86 GEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSG 150

  Fly   131 MVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSWSNTTPFLELLCAQ 195
            .|.|:||:|::.:.|..:.. ||||...|....|...||||::|:|....:....||..:.:.:|
Mouse   151 RVKGFLSQDSVTVGGITVTQ-TFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQ 214

  Fly   196 RLLEKCVFSVYLRRDPR----EIVFGGFDESKFEGKLHYVPVSQWHTWSLQISKSSVGTKQIGGK 256
            .:|::.|||||..|...    |:|.||.|...::|..|||.:|:..:|.:.:...|||:..:..:
Mouse   215 GVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCE 279

  Fly   257 SN--AILDTGTSLVLVPQQTYHNLLNTLSAKLQN-GYFVVACKS-GSLPNINILIGDKVFPLTSS 317
            ..  .::|||:|.:..|..:...::..|.||.:. ..:||.|.. .:||:|:..:|.:.:.|:|:
Mouse   280 EGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSST 344

  Fly   318 DYIMEVLLDRKPACVLA-----IAPINRGFWVLGDIFLRRYYTVFDATEKRIGLAKAK 370
            ||:::....|...|.||     |.|.....||||..|:|::||.||....|||.|.|:
Mouse   345 DYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 118/319 (37%)
Asp 63..369 CDD:278455 118/318 (37%)
Ren1NP_112469.1 A1_Propeptide 29..54 CDD:285240 6/24 (25%)
renin_like 76..401 CDD:133154 120/325 (37%)
Asp 83..401 CDD:278455 118/318 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.