DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and asp-4

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_510191.1 Gene:asp-4 / 181444 WormBaseID:WBGene00000217 Length:444 Species:Caenorhabditis elegans


Alignment Length:334 Identity:120/334 - (35%)
Similarity:191/334 - (57%) Gaps:15/334 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QLQLLLQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSS 115
            ::..||:.:.:.:|:|||::|.|.|||||||||||||.|:||..||..:.||..|.:|:|..||:
 Worm    81 EIDELLRNYMDAQYFGTISIGTPAQNFTVIFDTGSSNLWIPSKKCPFYDIACMLHHRYDSKSSST 145

  Fly   116 YIPDGRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVL 180
            |..|||...::||:|.:.|::|||::.:||.......|.|:.......|.:.||||::|:....:
 Worm   146 YKEDGRKMAIQYGTGSMKGFISKDSVCVAGVCAEDQPFAEATSEPGITFVAAKFDGILGMAYPEI 210

  Fly   181 SWSNTTPFLELLCAQRLLEKCVFSVYLRRDP-----REIVFGGFDESKFEGKLHYVPVSQWHTWS 240
            :.....|....|..|:.:...:||.:|.|:|     .||.|||.|..::...:.||||::...|.
 Worm   211 AVLGVQPVFNTLFEQKKVPSNLFSFWLNRNPDSEIGGEITFGGIDSRRYVEPITYVPVTRKGYWQ 275

  Fly   241 LQISKSSVGTKQIGGKS--NAILDTGTSLVLVPQQTYHNLLNTLSAK-LQNGYFVVAC-KSGSLP 301
            .::.| .||:..:|..:  .||.||||||:..|:.....:.|.:.|: |..|.::::| |..:||
 Worm   276 FKMDK-VVGSGVLGCSNGCQAIADTGTSLIAGPKAQIEAIQNFIGAEPLIKGEYMISCDKVPTLP 339

  Fly   302 NINILIGDKVFPLTSSDYIMEVLLDRKPACVLAIAPIN-----RGFWVLGDIFLRRYYTVFDATE 361
            .::.:||.:.|.|...||:::|....|..|:.....|:     ...|:|||:|:.|||:|||..:
 Worm   340 PVSFVIGGQEFSLKGEDYVLKVSQGGKTICLSGFMGIDLPERVGELWILGDVFIGRYYSVFDFDQ 404

  Fly   362 KRIGLAKAK 370
            .|:|.|:||
 Worm   405 NRVGFAQAK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 115/320 (36%)
Asp 63..369 CDD:278455 116/319 (36%)
asp-4NP_510191.1 pepsin_retropepsin_like 88..411 CDD:386101 115/323 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S917
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.