DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and asp-6

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_505133.1 Gene:asp-6 / 179209 WormBaseID:WBGene00000219 Length:389 Species:Caenorhabditis elegans


Alignment Length:328 Identity:95/328 - (28%)
Similarity:156/328 - (47%) Gaps:32/328 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDGRNFTL 125
            :.||.|.|.:|.|.|.|.|:.||||||.|:|...|   .:.|:...|::|:.||:::.:|:::|:
 Worm    68 DFEYLGNITIGTPDQGFIVVLDTGSSNLWIPGPTC---KTNCKTKSKFDSTASSTFVKNGKSWTI 129

  Fly   126 RYGSGMVVGYLSKDTMHIAGAE------LPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSWSN 184
            :||||...|.|.:||:.. ||:      :|..|||.:..:. ..|.:...||::||....|:...
 Worm   130 QYGSGDAAGILGQDTVRF-GAKGDSQLSVPTTTFGIASKIS-ADFKNDATDGILGLAFTSLAVDG 192

  Fly   185 TTPFLELLCAQRLLEKCVFSVYLRRDPRE-------IVFGGFDESKFEGKLHYVPVSQWHTWSLQ 242
            ..|.|.....|.:|::.:|||:|......       ..:|..|.:.....:.|.|:|....:..:
 Worm   193 VVPPLINAINQGILDQPLFSVWLEHRGAANNVGGGVFTYGAIDTTNCGALVAYQPLSSATYYQFK 257

  Fly   243 ISKSSVGTKQIGGKSNAILDTGTSLVLVPQQTYHNLLNTLSA---KLQNGYFV-VACKSGSLPNI 303
            .:...:|:.......:.|.|||||.:..||.....|.....|   .....||: .|.:.|:|   
 Worm   258 AAGFKLGSYSNTKTVDVISDTGTSFLGGPQSVVDGLAKAAGATYDDFNEVYFIDCAAQPGTL--- 319

  Fly   304 NILIGDKVFPLTSSDYIMEVLLDRKPACVLAIAPINRG----FWVLGDIFLRRYYTVFDATEKRI 364
            :|.||...:.:...:||::.   ....|:.|..|.:.|    .|:|||.|:|:|..::|...||:
 Worm   320 DITIGTNTYSIQPVNYIVDA---GNGQCLFAAFPFDFGGFGPSWILGDPFIRQYCNIYDIGNKRM 381

  Fly   365 GLA 367
            |.|
 Worm   382 GFA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 95/328 (29%)
Asp 63..369 CDD:278455 95/326 (29%)
asp-6NP_505133.1 Asp 70..385 CDD:278455 95/326 (29%)
pepsin_like 71..385 CDD:133138 94/325 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.