DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and Ctse

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_031825.2 Gene:Ctse / 13034 MGIID:107361 Length:397 Species:Mus musculus


Alignment Length:403 Identity:133/403 - (33%)
Similarity:209/403 - (51%) Gaps:49/403 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLCFLLAFLSLVFATQKILKVPLYVRRSFNESEVFLARSATEGGETLQLQLLLQTHN-------- 60
            ::..||..|.|..|...:.:|||...:|..:      :...:|    ||....::||        
Mouse     5 LVLLLLLLLDLAQAQGALHRVPLRRHQSLRK------KLRAQG----QLSEFWRSHNLDMTRLSE 59

  Fly    61 ----------------NMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYN 109
                            :|||:|||::|.|.|||||||||||||.|:|||.|  ::.||:.|..::
Mouse    60 SCNVYSSVNEPLINYLDMEYFGTISIGTPPQNFTVIFDTGSSNLWVPSVYC--TSPACKAHPVFH 122

  Fly   110 SSRSSSYIPDGRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVG 174
            .|:|.:|...|.:|:::||:|.:.|.:..|.:.:.|..:....||||:......|.:.:|||::|
Mouse   123 PSQSDTYTEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVDGQQFGESVKEPGQTFVNAEFDGILG 187

  Fly   175 LGLGVLSWSNTTPFLELLCAQRLLEKCVFSVYLRRDPR-----EIVFGGFDESKFEGKLHYVPVS 234
            ||...|:....||..:.:.||.|:...:|||||..||:     |:.|||:|.|.|.|.|:::||:
Mouse   188 LGYPSLAAGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVT 252

  Fly   235 QWHTWSLQISKSSVGTKQI--GGKSNAILDTGTSLVLVPQQTYHNLLNTLSAKLQNGYFVVACKS 297
            :...|.:.:....||...:  .....||:||||||:..|......|...:.|...:|.:.|.|.:
Mouse   253 KQAYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPDKIKQLQEAIGATPIDGEYAVDCAT 317

  Fly   298 -GSLPNINILIGDKVFPLTSSDYIMEVLLDRKPAC-----VLAIAPINRGFWVLGDIFLRRYYTV 356
             .::||:..||.:..:.|..:|||:..|::....|     .|.|.|.....|:|||:|:|::|:|
Mouse   318 LDTMPNVTFLINEVSYTLNPTDYILPDLVEGMQFCGSGFQGLDIPPPAGPLWILGDVFIRQFYSV 382

  Fly   357 FDATEKRIGLAKA 369
            ||....::|||.|
Mouse   383 FDRGNNQVGLAPA 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 117/319 (37%)
Asp 63..369 CDD:278455 117/318 (37%)
CtseNP_031825.2 A1_Propeptide 22..50 CDD:285240 7/37 (19%)
Asp 78..395 CDD:278455 117/318 (37%)
pepsin_retropepsin_like 79..394 CDD:299705 115/316 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S917
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.