DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and Ctsd

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_034113.1 Gene:Ctsd / 13033 MGIID:88562 Length:410 Species:Mus musculus


Alignment Length:412 Identity:144/412 - (34%)
Similarity:217/412 - (52%) Gaps:56/412 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLCFLLAFL-SLVFATQKILKVPLYVRRSFNESEVFLARSATE-GGETLQLQL------------ 54
            ||..:|..| |..||   |:::||   |.|..    :.|:.|| ||....|.|            
Mouse     6 VLLLILGLLASSSFA---IIRIPL---RKFTS----IRRTMTEVGGSVEDLILKGPITKYSMQSS 60

  Fly    55 ---------LLQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNS 110
                     ||:.:.:.:|||.|.:|.|.|.|||:|||||||.|:||::|.:.:.||..|.||||
Mouse    61 PKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNS 125

  Fly   111 SRSSSYIPDGRNFTLRYGSGMVVGYLSKDTMHI---------AGAELPHFTFGESLFLQHFAFSS 166
            .:||:|:.:|.:|.:.||||.:.||||:||:.:         .|.::....|||:.......|.:
Mouse   126 DKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVA 190

  Fly   167 VKFDGLVGLGLGVLSWSNTTPFLELLCAQRLLEKCVFSVYLRRDPR-----EIVFGGFDESKFEG 226
            .||||::|:|...:|.:|..|..:.|..|:|::|.:||.||.|||.     |::.||.|...:.|
Mouse   191 AKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHG 255

  Fly   227 KLHYVPVSQWHTWSLQISKSSVGTK--QIGGKSNAILDTGTSLVLVPQQTYHNLLNTLSA-KLQN 288
            :|.|:.|::...|.:.:.:..||.:  ...|...||:||||||::.|.:....|...:.| .|..
Mouse   256 ELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQ 320

  Fly   289 GYFVVAC-KSGSLPNINILIGDKVFPLTSSDYIMEVLLDRKPACV-----LAIAPINRGFWVLGD 347
            |.:::.| |..|||.:.:.:|.|.:.|....||::|....|..|:     :.|.|.:...|:|||
Mouse   321 GEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGD 385

  Fly   348 IFLRRYYTVFDATEKRIGLAKA 369
            :|:..||||||....|:|.|.|
Mouse   386 VFIGSYYTVFDRDNNRVGFANA 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 121/329 (37%)
Asp 63..369 CDD:278455 122/328 (37%)
CtsdNP_034113.1 A1_Propeptide 21..46 CDD:285240 10/31 (32%)
Cathepsin_D2 73..405 CDD:133157 121/331 (37%)
Asp 78..407 CDD:278455 122/328 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.