DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and LOC101735147

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_031756605.1 Gene:LOC101735147 / 101735147 -ID:- Length:337 Species:Xenopus tropicalis


Alignment Length:331 Identity:129/331 - (38%)
Similarity:189/331 - (57%) Gaps:18/331 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LLLQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIP 118
            |.||.    :|||.|.:|...|||||:|||||||.|:|||:|.|.:.||..|.||:||:||:|:.
 Frog    11 LYLQA----QYYGEIGLGTAPQNFTVVFDTGSSNLWVPSVHCSMLDIACWMHHKYDSSKSSTYVK 71

  Fly   119 DGRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSWS 183
            :|..|.::||:|.:.|||||||:.|....:....|||::......|.:.||||::|:...|:|..
 Frog    72 NGTAFAIQYGTGSLSGYLSKDTVTIGNLAVKGQIFGEAVKQPGVTFVAAKFDGILGMAYPVISVD 136

  Fly   184 NTTPFLELLCAQRLLEKCVFSVYLRRDP-----REIVFGGFDESKFEGKLHYVPVSQWHTWSLQI 243
            ...|..:.:.||:|:|..:||.||.|:|     .|::.||.|...:.|..||:.|::...|.:.:
 Frog   137 GAPPVFDNIMAQKLVESNIFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFHYLSVTRKAYWQIHM 201

  Fly   244 SKSSVGTK--QIGGKSNAILDTGTSLVLVPQQTYHNLLNTLSA-KLQNGYFVVAC-KSGSLPNIN 304
            .:..||.:  ...|....|:||||||:..|.:....|...:.| .|..|.::|.| |..:||.|:
 Frog   202 DQLGVGDQLTLCKGGCEVIVDTGTSLITGPLEEVTALQKAIGAVPLIQGQYMVQCDKVPTLPVIS 266

  Fly   305 ILIGDKVFPLTSSDYIMEVLLDRKPACV-----LAIAPINRGFWVLGDIFLRRYYTVFDATEKRI 364
            :.:|.:|:.||...|||:|.......|:     |.|.|.....|:|||:|:.:||:|||....|:
 Frog   267 LTLGGQVYTLTGEQYIMKVSQLGSTICLSGFMGLNIPPPAGPLWILGDVFIGQYYSVFDRANNRV 331

  Fly   365 GLAKAK 370
            |.||||
 Frog   332 GFAKAK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 122/320 (38%)
Asp 63..369 CDD:278455 123/319 (39%)
LOC101735147XP_031756605.1 Cathepsin_D2 12..335 CDD:133157 124/326 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.