DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and LOC101732307

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_031751054.1 Gene:LOC101732307 / 101732307 -ID:- Length:381 Species:Xenopus tropicalis


Alignment Length:380 Identity:132/380 - (34%)
Similarity:196/380 - (51%) Gaps:48/380 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ILKVPLY----VRRSFNES----EVFLARSATEGGETLQLQLLLQTH--------NNM--EYYGT 67
            :::|||.    :|::..||    .:|.:.|....|:  ...||..||        |.|  :|:||
 Frog    16 LVRVPLQRGTSLRQTLIESRFPENLFHSLSMDLAGK--YSSLLDNTHLSFIEPLTNYMDNQYFGT 78

  Fly    68 IAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDGRNFTLRYGSGMV 132
            |::|.|.|.|.|:|||||:|.|:|||.|  |::||.||.:::...||::.|..:..::.||:|.:
 Frog    79 ISIGTPPQEFNVVFDTGSANLWIPSVTC--SSAACTNHNQFDPKLSSTFQPGNKMVSISYGTGSM 141

  Fly   133 VGYLSKDTMHIA-------GAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSWSNTTPFLE 190
            .|.|..||:.:.       |..|..   .||:||    |.| ||||::|||...||..:.||..:
 Frog   142 SGALGFDTVQVGDIVDRNQGLLLSE---TESIFL----FYS-KFDGILGLGYPSLSVGDVTPVFD 198

  Fly   191 LLCAQRLLEKCVFSVYL-RRDPREIVFGGFDESKFE-GKLHYVPVSQWHTWSLQISKSSVGTKQI 253
            .:..:.|:.:.:|||.| ......:||||.|.|.|. |:|.:|||:....|.:.:...::..:.|
 Frog   199 NMWKEELINEDLFSVCLTSHKGSAVVFGGIDGSCFAGGELQWVPVTAQKYWQITVDSVTINGQII 263

  Fly   254 GGKSN--AILDTGTSLVLVPQQTYHNLLNTLSAKLQN-GYFVVACKS-GSLPNINILIGDKVFPL 314
            ..:.:  ||:|||||::.........:...:.||... |.|.|:|:| .|||.|.|.|....:||
 Frog   264 ACRESCQAIVDTGTSVIAGHPGAIRTIQGAIGAKADKYGLFTVSCESVSSLPEIIITINGIGYPL 328

  Fly   315 TSSDYIMEVLLDRKPACVLAIAPINRGFWVLGDIFLRRYYTVFDATEKRIGLAKA 369
            .:..||.:.     |....:......|.|:|||||||.|:||||....|||.|.|
 Frog   329 PARAYISQF-----PGSCSSGFQATSGPWILGDIFLREYFTVFDRGNNRIGFAPA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 116/321 (36%)
Asp 63..369 CDD:278455 116/318 (36%)
LOC101732307XP_031751054.1 A1_Propeptide 16..>33 CDD:400357 4/16 (25%)
pepsin_retropepsin_like 65..377 CDD:416259 117/326 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.