DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and LOC100493461

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_002938556.2 Gene:LOC100493461 / 100493461 -ID:- Length:402 Species:Xenopus tropicalis


Alignment Length:404 Identity:127/404 - (31%)
Similarity:212/404 - (52%) Gaps:42/404 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRVLCFLLAFLSLVFATQKI-------LKVPLYVRRSFNE------SEVFLARSATE-------- 45
            ::||..|:..:.|....:::       ::..|:.|...||      ..:| ||..|:        
 Frog     1 MKVLLILVGCIQLATPLERVPLVKFKSIRSHLWQRDELNEFWLHHQPHIF-ARKYTQCFPPPYSL 64

  Fly    46 -GGETLQLQLLLQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYN 109
             .|.|.:   .|..:.|.:|||.|::|.|.|||:|:|||||||.|:||..|  .:.|||.|.::.
 Frog    65 AAGTTTE---YLVDYMNAQYYGEISVGTPPQNFSVVFDTGSSNFWVPSSYC--LSEACQVHERFK 124

  Fly   110 SSRSSSYIPDGRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVG 174
            |..|:||...||.|::.||:|.:||...:||:.|:...:....||||:......|...:|||::|
 Frog   125 SFESTSYEHGGRPFSIHYGTGQLVGVTGRDTLRISNMSIEGQDFGESILEPGRTFVLAQFDGVLG 189

  Fly   175 LGLGVLSWSNTTPFLELLCAQRLLEKCVFSVYLRRD-----PREIVFGGFDESKFEGKLHYVPVS 234
            ||...|:.:...|..:.:..|:|:|:.:||.:|.||     ..|::|||.|.|.::|::|::|::
 Frog   190 LGYPSLAVAGAVPVFDRIVNQKLVEQQLFSFHLNRDYDSEYGGELIFGGIDHSLYKGQIHWIPLT 254

  Fly   235 QWHTWSLQISKSSVGTKQIGGKSN--AILDTGTSLVLVPQQTYHNLLNTLSA--KLQNGYFVVAC 295
            :...|.:::....|..:.:..:|:  .|:|:||||:..|:.....|...|.|  .|...|.:...
 Frog   255 EKGYWQIRLDNVKVDGEAMFCQSSCQVIVDSGTSLITGPKAEIKKLQELLGATPTLFGEYILDCS 319

  Fly   296 KSGSLPNINILIGDKVFPLTSSDYIMEVLLDRKPACV-----LAIAPINRGFWVLGDIFLRRYYT 355
            :..|||.:...||.:.:.||...|.::....:...|:     :.|:..:...|:|||||:.::|:
 Frog   320 RVSSLPRVTFTIGQRDYTLTPEQYTIKERSQKSDFCLTGFQAMDISTKDGPLWILGDIFMSKFYS 384

  Fly   356 VFDATEKRIGLAKA 369
            |||....||||||:
 Frog   385 VFDREHDRIGLAKS 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 110/320 (34%)
Asp 63..369 CDD:278455 110/319 (34%)
LOC100493461XP_002938556.2 A1_Propeptide 17..45 CDD:400357 4/27 (15%)
pepsin_retropepsin_like 75..397 CDD:416259 110/323 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1428
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.