DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and LOC100489782

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_002933028.1 Gene:LOC100489782 / 100489782 -ID:- Length:383 Species:Xenopus tropicalis


Alignment Length:395 Identity:131/395 - (33%)
Similarity:198/395 - (50%) Gaps:51/395 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLLAFLSLVFATQKILKVPLYVRRSFNESEVFLARSATEGGETLQLQLLLQTHN----------- 60
            ||:..|..:..::.:::|||...:|       :.::..|.|   .|...||||.           
 Frog     3 FLILILVCLQLSEGLVRVPLMKSKS-------IRQNMAEAG---VLDKYLQTHKIDLSSRYRGYA 57

  Fly    61 --------NMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYI 117
                    :..|||.|::|.|.|||.|:|||||||.|:||..|  .:|||.||..:..|:||:|.
 Frog    58 VVTESMYFDTYYYGPISIGTPPQNFLVLFDTGSSNLWVPSSYC--QSSACTNHNVFKPSQSSTYS 120

  Fly   118 PDGRNFTLRYGSG----MVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLG 178
            .:|:.||:.||.|    .|.|....||:.|.|..:.:..||.::......|....|||::||...
 Frog   121 SNGQKFTMGYGGGNVASSVTGLFGYDTVSIQGISITNQEFGLTITEPTSNFYYSPFDGILGLAYP 185

  Fly   179 VLSWSNTTPFLELLCAQRLLEKCVFSVYLRRDPREIVFGGFDESKFEGKLHYVPVSQWHTWSLQI 243
            .||.......|:.:..:.||...:||:||.....||:|||.|.:.:.|::::.|:||...|.:.:
 Frog   186 GLSVEGAQTVLQGMMQENLLNPSMFSIYLGSQSGEIIFGGVDSNLYTGQIYWAPLSQELYWQVAL 250

  Fly   244 SKSSVGTKQIGGKS---NAILDTGTSLVLVPQQTYHNLLNTLSAKLQNGYFVVACKS-GSLPNIN 304
            .:.|:..:..|..|   .||:||||:.:.:||.....||..|..:.|||.:.|.|.: .:||.::
 Frog   251 QEFSINGQATGWCSQGCQAIVDTGTTQLNIPQTYLTKLLPYLGIQTQNGGYYVNCNNLQNLPTLS 315

  Fly   305 ILIGDKVFPLTSSDYIMEVLLDRKPACV-----LAIAPINRG--FWVLGDIFLRRYYTVFDATEK 362
            ..|....|||..|.||::    ....|.     |:: |...|  .|:|||:|||:||:|||....
 Frog   316 FTINGVSFPLPPSAYIIQ----ENGYCYANFLNLSL-PAQNGQPLWILGDVFLRQYYSVFDYGNN 375

  Fly   363 RIGLA 367
            :||.|
 Frog   376 QIGFA 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 117/322 (36%)
Asp 63..369 CDD:278455 117/320 (37%)
LOC100489782XP_002933028.1 A1_Propeptide 17..45 CDD:369623 9/37 (24%)
pepsin_retropepsin_like 66..381 CDD:386101 117/322 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.