DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and ren

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_017947014.2 Gene:ren / 100487524 XenbaseID:XB-GENE-480535 Length:395 Species:Xenopus tropicalis


Alignment Length:392 Identity:116/392 - (29%)
Similarity:200/392 - (51%) Gaps:32/392 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CFLLAFLSLVFATQKILKVPLYVRRSFNESEVFLARSATEGGETLQLQLL-------------LQ 57
            |..|.:|.:| ......::||....|..|:...:....|:....|:::.|             |.
 Frog     3 CLPLFYLFMV-TCDCFRRIPLNRMPSIRETLQSMGVKVTDAFPQLRMKALADKNPNNGTAPTVLT 66

  Fly    58 THNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDGRN 122
            .:.:.:|:|.|::|:|.|.|.|:|||||:|.|:||..|....|||.:|.:|:|::|.:|:.:|..
 Frog    67 NYMDTQYFGEISIGSPPQTFKVVFDTGSANLWVPSQRCSPLYSACVSHNRYDSTKSQTYMENGAG 131

  Fly   123 FTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSWSNTTP 187
            |:::||||.|.|:||:|.:.:||..:.. .|.|:..|..|.|...:|||::|:|....:....||
 Frog   132 FSIQYGSGGVKGFLSQDVVVVAGIPVIQ-VFAEATALPAFPFIFARFDGVLGMGFPGQAIDGITP 195

  Fly   188 FLELLCAQRLLEKCVFSVYLRRDPR--------EIVFGGFDESKFEGKLHYVPVSQWHTWSLQIS 244
            ..:.:.::::|::.|||||..|..|        ||:.||.|.|.:.|...|:.:.:...|.:::.
 Frog   196 VFDRIISEQVLQEDVFSVYYSRSYRDSHLKPGGEIILGGSDPSYYTGSFQYLNLEKEGYWHIRMK 260

  Fly   245 KSSVGTKQIGGKS--NAILDTGTSLVLVPQQTYHNLLNTLSA-KLQNGYFVVAC-KSGSLPNINI 305
            ..|:|.:.:..|.  :..:|||.:.:..|..:...|:..:.| :|..|.:.|.| |...||:::.
 Frog   261 GVSIGAEILFCKDGCSVAIDTGAAYITGPASSVSVLMKAIGATELAEGEYTVDCDKISQLPDVSF 325

  Fly   306 LIGDKVFPLTSSDYIMEVLLDRKPACVLAIAPIN-----RGFWVLGDIFLRRYYTVFDATEKRIG 365
            .:|...:.|....||::.....:..|.:|..|::     ...|:||..|:.:|||.||....|||
 Frog   326 HMGGNEYTLKGPAYILQQSQFGEEICSVAFTPLDIPPPVGPLWILGASFIGQYYTEFDRRNNRIG 390

  Fly   366 LA 367
            .|
 Frog   391 FA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 104/324 (32%)
Asp 63..369 CDD:278455 104/322 (32%)
renXP_017947014.2 A1_Propeptide 17..>33 CDD:400357 4/15 (27%)
pepsin_retropepsin_like 65..394 CDD:416259 105/329 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.