DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5860 and ctse

DIOPT Version :9

Sequence 1:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001120469.1 Gene:ctse / 100145572 XenbaseID:XB-GENE-947864 Length:397 Species:Xenopus tropicalis


Alignment Length:395 Identity:133/395 - (33%)
Similarity:207/395 - (52%) Gaps:39/395 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRVLCFLLAFLSLVFATQKILKVPL----YVRRSFNESEVFLARSATEGGETLQLQLLLQTHNN- 61
            :|.:..||.|.:||:.   :::|||    .:|:...|... |:...|:.|..: :|......|| 
 Frog     1 MRQILLLLLFATLVYG---LIRVPLKRQKSIRKKLKEKGK-LSHVWTQQGIDM-IQYTDSCSNNQ 60

  Fly    62 -----------MEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSS 115
                       :||:|.|::|.|.|||||||||||||.|:|||.|  .:.||..|.::....||:
 Frog    61 APSEPLINYMDVEYFGEISIGTPPQNFTVIFDTGSSNLWVPSVYC--ISPACAQHNRFQPQFSST 123

  Fly   116 YIPDGRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVL 180
            |..:|.||:|:||:|.:.|.:..|::.:.|..:....||||:......|...:|||::|||...:
 Frog   124 YQSNGNNFSLQYGTGSLSGIIGTDSVSVEGILVQSQQFGESVSEPGSTFVDAEFDGILGLGYPSI 188

  Fly   181 SWSNTTPFLELLCAQRLLEKCVFSVYLRRDPR-----EIVFGGFDESKFEGKLHYVPVSQWHTWS 240
            :..:.||..:.:..|.|:|..:||||:.|:|.     |:||||||.|:|.|:|::|.|:....|.
 Frog   189 AVGDCTPVFDNMMTQNLVELPMFSVYMSRNPNSPVGGELVFGGFDASRFSGQLNWVSVTNQGYWQ 253

  Fly   241 LQISKSSVGTKQI--GGKSNAILDTGTSLVLVPQQTYHNLLNTLSAKLQNGYFVVACK-SGSLPN 302
            :|:....:..:.:  .|...||:||||||:..|......|.:.:.|...||.:.|.|. ...:|.
 Frog   254 IQLDNIQINGEVVFCTGGCQAIVDTGTSLITGPSSDIVQLQSIIGASAANGDYEVDCSVLNEMPT 318

  Fly   303 INILIGDKVFPLTSSDYIMEVLLDRKPACV-----LAIAPINRGFWVLGDIFLRRYYTVFDATEK 362
            :...|....:.:|...|.::   |....|.     |.|:|.....|:|||:|:.:||:|||....
 Frog   319 VTFTINGIGYQMTPQQYTLQ---DGGGICSSGFQGLDISPPAGPLWILGDVFIGQYYSVFDRGNN 380

  Fly   363 RIGLA 367
            |:|||
 Frog   381 RVGLA 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 117/332 (35%)
Asp 63..369 CDD:278455 116/318 (36%)
ctseNP_001120469.1 A1_Propeptide 17..42 CDD:369623 6/25 (24%)
pepsin_retropepsin_like 74..386 CDD:386101 115/317 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1428
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.140

Return to query results.
Submit another query.