DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and BAR1

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_012249.1 Gene:BAR1 / 854797 SGDID:S000001277 Length:587 Species:Saccharomyces cerevisiae


Alignment Length:378 Identity:98/378 - (25%)
Similarity:156/378 - (41%) Gaps:71/378 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNIWV---PGPHC--------------------KS 183
            |::...|.|...::||||.|..|||.||||::.||   ..|.|                    .|
Yeast    37 LQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFCLPNSNTSSYSNATYNGEEVKPS 101

  Fly   184 KACKKHKQYHPAKSST--YVKNGKSFAITYGSGSVA-GVLAKDTVRIAGLVVTNQTFAMTTKEPG 245
            ..|:....|:..:|||  |::||: |.|||..|:.| |....:||.|.|:.:.|..|.:      
Yeast   102 IDCRSMSTYNEHRSSTYQYLENGR-FYITYADGTFADGSWGTETVSINGIDIPNIQFGV------ 159

  Fly   246 TTFVTSNFDGILGL---------GYRSIAVDNVKTLVQNMCSEDVITSCKFAICMKGGGSSSRGG 301
            ..:.|:...|:||:         ||.....:......|.:.||.:|....:::.:....|.:  |
Yeast   160 AKYATTPVSGVLGIGFPRRESVKGYEGAPNEYYPNFPQILKSEKIIDVVAYSLFLNSPDSGT--G 222

  Fly   302 AIIFGSSNTSAYSGS-------NSYTYTPVTKKGYWQFTLQDIYVGGTKVSGSVQ---------- 349
            :|:||:.:.|.:||.       |.|. |.|........|:|.:   |.:...|.:          
Yeast   223 SIVFGAIDESKFSGDLFTFPMVNEYP-TIVDAPATLAMTIQGL---GAQNKSSCEHETFTTTKYP 283

  Fly   350 AIVDSGTSLITAPTAIYNKINKVIGCR-ATSSGECWMKCAKKIPD--FTFVIAGKKFVVKGNKMK 411
            .::||||||:.||..|.:|:...:... :...|...:.|...:.|  :.|.....:..|..:.:.
Yeast   284 VLLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYILDCPVSVGDVEYNFDFGDLQISVPLSSLI 348

  Fly   412 LKVRTNRGRTVCISAVTEVPDEPVILGDAFIRHFCTEFDLANNRIGFAATTYS 464
            |...|.  .:.|..||....|. ::|||.|:......|||.|.:|..|...::
Yeast   349 LSPETE--GSYCGFAVQPTNDS-MVLGDVFLSSAYVVFDLDNYKISLAQANWN 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 97/371 (26%)
Asp 149..460 CDD:278455 95/365 (26%)
BAR1NP_012249.1 SAP_like 43..395 CDD:133141 97/367 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341761
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.