DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and AT1G69100

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001320489.1 Gene:AT1G69100 / 843242 AraportID:AT1G69100 Length:375 Species:Arabidopsis thaliana


Alignment Length:359 Identity:112/359 - (31%)
Similarity:174/359 - (48%) Gaps:36/359 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 SEKAFLANRYGFSFAKSSGTATLKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNIWVPGPHCKSK 184
            |.|....|..|.||      ..|||...:.:..::::|:|.|||.|:.||||:::|||......:
plant    31 SLKRHTLNVGGTSF------GGLKNFDGVVFYGEISVGSPPQKFNVVFDTGSTDLWVPSKEWPEE 89

  Fly   185 ACKKHKQYHPAKSST-YVKNGKSFAITYGSGSVAGVLAKDTVRIAGLVVTNQTFAMTTKEPGTTF 248
            ...||.::....|.| .:..|....|.|.:|||.|:||:|.|.:.|:|:.:|...: .:.|.|.|
plant    90 TDHKHPKFDKDASKTCRLMKGGEVNIAYETGSVVGILAQDNVNVGGVVIKSQDLFL-ARNPDTYF 153

  Fly   249 VTSNFDGILGLGYRSIAVDNVKTLVQNMCSEDVITSCKFAICM---KG-GGSSSRGGAIIFGSSN 309
            .:..|||::|||.:|.......|:.:||..:.:||...|::.:   || ||....||.|:||..:
plant   154 RSVKFDGVIGLGIKSSRAQGSVTVWENMVKQKLITKPIFSLYLRPHKGDGGEDPNGGQIMFGGFD 218

  Fly   310 TSAYSGSNSYTYTPV-TKKGYWQFTLQDIYVGGTKVSG-----SVQAIVDSGTSLITAPTAIYNK 368
            ...:.|  .:.|.|: .....|:..:..||:.|.....     ...|:||||::.|..|.....|
plant   219 PKQFKG--EHVYVPMKLSDDRWKIKMSKIYINGKPAINFCDDVECTAMVDSGSTDIFGPDEAVGK 281

  Fly   369 INKVIGCRATSSGECWMKCAK--KIPDFTFVIAGKKFVVKGNKMKLKVRTN---RGRTVCISAVT 428
            |.|.||  ||   :..::|.:  .:||..|.|.||...:..:.. ::|:||   |.|...:.:..
plant   282 IYKEIG--AT---KVIIRCEQFPALPDIYFEIGGKHLRLTKHDY-VEVKTNPKKRCRLRIVKSKN 340

  Fly   429 EVPDEPVILGDAFIRHFCTEF---DLANNRIGFA 459
            ...|  .:||:||:..|.|.|   |:...|||||
plant   341 RRKD--WVLGEAFMTKFHTVFDYGDVKTPRIGFA 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 104/335 (31%)
Asp 149..460 CDD:278455 103/330 (31%)
AT1G69100NP_001320489.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.