DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and AT5G45120

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_199325.1 Gene:AT5G45120 / 834548 AraportID:AT5G45120 Length:491 Species:Arabidopsis thaliana


Alignment Length:418 Identity:88/418 - (21%)
Similarity:140/418 - (33%) Gaps:132/418 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 YTCKMNIGTPKQKFTVLPDTGSSNIWVP-------------------------GP---------H 180
            |...:|||||.|...|..||||...|||                         .|         .
plant    83 YLITLNIGTPPQAVQVYLDTGSDLTWVPCGNLSFDCIECYDLKNNDLKSPSVFSPLHSSTSFRDS 147

  Fly   181 CKSKACKK-HKQYHP-------------AKSSTYVKNGKSFAITYGSGS-VAGVLAKDTVRIAGL 230
            |.|..|.: |...:|             ...||.|:...|||.|||.|. ::|:|.:|.::    
plant   148 CASSFCVEIHSSDNPFDPCAVAGCSVSMLLKSTCVRPCPSFAYTYGEGGLISGILTRDILK---- 208

  Fly   231 VVTNQTFAMTTKEPGTTF--VTSNFD---GILGLGYRSIAVDNVKTLVQNMCSEDVITSCKFAIC 290
                   |.|...|..:|  |||.:.   ||.|.|...:::.:....::.          .|:.|
plant   209 -------ARTRDVPRFSFGCVTSTYREPIGIAGFGRGLLSLPSQLGFLEK----------GFSHC 256

  Fly   291 ---MKGGGSSSRGGAIIFGSSNTSAYSGSNSYTYTPVTKKGYWQFTLQDIYVG------GTKVS- 345
               .|...:.:....:|.|:|..| .:.::|..:||:.....:.   ...|:|      ||.:: 
plant   257 FLPFKFVNNPNISSPLILGASALS-INLTDSLQFTPMLNTPMYP---NSYYIGLESITIGTNITP 317

  Fly   346 -------------GSVQAIVDSGTSLITAPTAIYNKI-----NKVIGCRATSSGE------CW-M 385
                         |:...:|||||:....|...|:::     :.:...|||.:..      |: :
plant   318 TQVPLTLRQFDSQGNGGMLVDSGTTYTHLPEPFYSQLLTTLQSTITYPRATETESRTGFDLCYKV 382

  Fly   386 KCAKK------------IPDFTFVIAGKKFVV--KGNKMKLKVRTNRGRTVCISAVTEVPDEPV- 435
            .|...            .|..||.......::  :||........:.|..|.......:.|... 
plant   383 PCPNNNLTSLENDVMMIFPSITFHFLNNATLLLPQGNSFYAMSAPSDGSVVQCLLFQNMEDGDYG 447

  Fly   436 ---ILGDAFIRHFCTEFDLANNRIGFAA 460
               :.|....::....:||...||||.|
plant   448 PAGVFGSFQQQNVKVVYDLEKERIGFQA 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 86/415 (21%)
Asp 149..460 CDD:278455 87/416 (21%)
AT5G45120NP_199325.1 pepsin_retropepsin_like 74..>135 CDD:299705 15/51 (29%)
pepsin_A_like_plant 82..478 CDD:133143 88/418 (21%)
Asp 83..473 CDD:278455 85/414 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.