DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and AT5G37540

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_568551.1 Gene:AT5G37540 / 833732 AraportID:AT5G37540 Length:442 Species:Arabidopsis thaliana


Alignment Length:435 Identity:95/435 - (21%)
Similarity:158/435 - (36%) Gaps:105/435 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ATLPLDFQQNFVR--TTDNLRSEKAFLANRYGFSFAKSSGTATLKNTANMEYTCKMNIGTPKQKF 163
            ::|.|.|....:|  .|.|..|.|..|.:|...|...|..|.......:|.....:.||||.|..
plant    29 SSLSLHFPLTSLRLTPTTNSSSFKTSLLSRRNPSPPSSPYTFRSNIKYSMALILSLPIGTPSQSQ 93

  Fly   164 TVLPDTGSSNIWVPGPHCKSKACKK-----HKQYHPAKSSTYVKNGKS----------------- 206
            .::.||||...|:   .|..|..||     ...:.|:.||::.....|                 
plant    94 ELVLDTGSQLSWI---QCHPKKIKKPLPPPTTSFDPSLSSSFSDLPCSHPLCKPRIPDFTLPTSC 155

  Fly   207 -------FAITYGSGSVA-GVLAKDTVRIAGLVVTNQTFAMTTKEPGTTFVTSNFDGILGLGYRS 263
                   ::..|..|:.| |.|.|:....:....|........||      :::..||||:    
plant   156 DSNRLCHYSYFYADGTFAEGNLVKEKFTFSNSQTTPPLILGCAKE------STDEKGILGM---- 210

  Fly   264 IAVDNVKTLVQNMCSEDVITSCKFAICMKGGGSSSRGGAIIFGSSNTSAYSGSNSYTYT------ 322
                |:..|  :..|:..|:  ||:.|:.  ..|:|.|....||........|..:.|.      
plant   211 ----NLGRL--SFISQAKIS--KFSYCIP--TRSNRPGLASTGSFYLGDNPNSRGFKYVSLLTFP 265

  Fly   323 -----PVTKKGYWQFTLQDIYVGGTKVS-----------GSVQAIVDSGTSLITAPTAIYNKIN- 370
                 |......:...||.|.:|..:::           ||.|.:||||:.........|:|:. 
plant   266 QSQRMPNLDPLAYTVPLQGIRIGQKRLNIPGSVFRPDAGGSGQTMVDSGSEFTHLVDVAYDKVKE 330

  Fly   371 ---KVIGCR-------ATSSGECW-----MKCAKKIPDFTFVIA-GKKFVVKGNKMKLKVR---- 415
               :::|.|       .:::..|:     |:..:.|.|..|... |.:.:|:...:.:.|.    
plant   331 EIVRLVGSRLKKGYVYGSTADMCFDGNHSMEIGRLIGDLVFEFGRGVEILVEKQSLLVNVGGGIH 395

  Fly   416 -TNRGRTVCISAVTEVPDEPVILGDAFIRHFCTEFDLANNRIGFA 459
             ...||:..:.|.:.      |:|:...::...|||:.|.|:||:
plant   396 CVGIGRSSMLGAASN------IIGNVHQQNLWVEFDVTNRRVGFS 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 81/390 (21%)
Asp 149..460 CDD:278455 81/385 (21%)
AT5G37540NP_568551.1 pepsin_A_like_plant 76..438 CDD:133143 82/388 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.