DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and AT5G24820

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_568459.1 Gene:AT5G24820 / 832551 AraportID:AT5G24820 Length:407 Species:Arabidopsis thaliana


Alignment Length:386 Identity:71/386 - (18%)
Similarity:135/386 - (34%) Gaps:107/386 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DNLRSEKAFLANRYGFSFAK-SSGTATLKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNIWVPGP 179
            ||....:..|:::...:|:. |...::|....:..||...|..|..      ..|..|.:..|..
plant    73 DNDDDHQCSLSDKSSNTFSTISCNNSSLCPHVSTNYTNYFNATTTN------TTTSVSLLCTPSD 131

  Fly   180 HCKSKACKKHKQYHPAKSSTYVKNGKSFAITYGSGSVAGVLAKDTVRIAGLVVTNQTFAMTTKEP 244
            .|:.:|                           |.|.:|.|..||:::        |.::|.:|.
plant   132 FCRYEA---------------------------SPSSSGYLVSDTLQL--------TSSITDQEN 161

  Fly   245 GTTFVTSNFDGILGLGYRSIA--------VDNVKTLVQ---NMCSEDVITSCKFAICMKGGGSSS 298
            ..:.|..   .:.|.|.|:.|        ||...:|..   ::.|:..:|  :|:.|:....:.|
plant   162 SLSIVRG---FVFGCGARNRATPEEDGGGVDGRLSLTTHRFSLLSQLRLT--RFSHCLWPSAAGS 221

  Fly   299 R-----GGAIIFGSSNTSA----YSGSNSYTYTPVTKKGYWQFTLQDIYVGGTKVSGSVQA--IV 352
            |     |.|..:|......    .:|:.:|:|         ...|..|.:|..::..:..:  .:
plant   222 RNYIRLGSAASYGGDMVLVPMLNMTGTEAYSY---------HVALFGISLGQQRMRSNESSGIAI 277

  Fly   353 DSGTSLITAPTAIYNKINK----VIG-----------CRATSSG-ECWMKCAKKIPDFTFVIAGK 401
            |.||...:...::|.::.:    .||           |..|..| |     ...:|..|....|.
plant   278 DVGTYYTSLEPSLYEEVKEELTAQIGPAVAYEVNELMCFTTEVGLE-----IDSLPKLTLHFQGL 337

  Fly   402 KFVVKGNKMKLKVRTNRGRTVCISAV-TEVPDEP---VILGDAFIRHFCTEFDLANNRIGF 458
            .:.:....:.|:   :...::|.:.| :.:.||.   |:...||:.| ...:|.:...:.|
plant   338 DYTISNKGLYLQ---DSPSSLCTALVRSSMKDEERINVLGASAFVDH-AVGYDTSQRMLAF 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 66/359 (18%)
Asp 149..460 CDD:278455 65/352 (18%)
AT5G24820NP_568459.1 pepsin_retropepsin_like 133..399 CDD:416259 58/320 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.