DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and PCS1

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_195839.1 Gene:PCS1 / 831845 AraportID:AT5G02190 Length:453 Species:Arabidopsis thaliana


Alignment Length:444 Identity:92/444 - (20%)
Similarity:152/444 - (34%) Gaps:124/444 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 SDSSYATLPLDFQQNFVRTTDNLRSEKAFLANRYGFSFAKSSGTATLKNTANMEYTCKMNIGTPK 160
            |.||..||.|..:.. :..||:..::|....:                   |:..|..:.:|||.
plant    39 SSSSSQTLVLPLKTR-ITPTDHRPTDKLHFHH-------------------NVTLTVTLTVGTPP 83

  Fly   161 QKFTVLPDTGSSNIWVPGPHC-KSKACKKHKQYHPAKSSTYV----------KNGKSFAI----- 209
            |..:::.||||...|:   .| :|........:.|.:||:|.          ...:.|.|     
plant    84 QNISMVIDTGSELSWL---RCNRSSNPNPVNNFDPTRSSSYSPIPCSSPTCRTRTRDFLIPASCD 145

  Fly   210 ---------TYGSGSVA-GVLAKDTVRIAGLVVTNQTFAMTTKEPGTTFVTSNFDGILGLGYRSI 264
                     :|...|.: |.||.:...          |..:|.:....|      |.:|....|.
plant   146 SDKLCHATLSYADASSSEGNLAAEIFH----------FGNSTNDSNLIF------GCMGSVSGSD 194

  Fly   265 AVDNVKT---LVQNMCSEDVITSC---KFAICMKGGGSSSRGGAIIFGSSNTSAYSGSNSYTYTP 323
            ..::.||   |..|..|...|:..   ||:.|:  .|:....|.::.|.||   ::......|||
plant   195 PEEDTKTTGLLGMNRGSLSFISQMGFPKFSYCI--SGTDDFPGFLLLGDSN---FTWLTPLNYTP 254

  Fly   324 V----TKKGYWQFTLQDIYVGGTKVSGSV----------------QAIVDSGT--SLITAP--TA 364
            :    |...|:......:.:.|.||:|.:                |.:|||||  :.:..|  ||
plant   255 LIRISTPLPYFDRVAYTVQLTGIKVNGKLLPIPKSVLVPDHTGAGQTMVDSGTQFTFLLGPVYTA 319

  Fly   365 I----YNKINKVIG---------------CRATSSGECWMKCAKKIPDFTFVIAGKKFVVKGNKM 410
            :    .|:.|.::.               |...|..........::|..:.|..|.:..|.|..:
plant   320 LRSHFLNRTNGILTVYEDPDFVFQGTMDLCYRISPVRIRSGILHRLPTVSLVFEGAEIAVSGQPL 384

  Fly   411 KLKV---RTNRGRTVCISAVTE--VPDEPVILGDAFIRHFCTEFDLANNRIGFA 459
            ..:|   ........|.:....  :..|..::|....::...||||..:|||.|
plant   385 LYRVPHLTVGNDSVYCFTFGNSDLMGMEAYVIGHHHQQNMWIEFDLQRSRIGLA 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 82/396 (21%)
Asp 149..460 CDD:278455 82/391 (21%)
PCS1NP_195839.1 pepsin_A_like_plant 82..442 CDD:133143 79/381 (21%)
Asp 82..440 CDD:278455 79/381 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.