DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and AT4G22050

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_193936.2 Gene:AT4G22050 / 828294 AraportID:AT4G22050 Length:354 Species:Arabidopsis thaliana


Alignment Length:384 Identity:120/384 - (31%)
Similarity:175/384 - (45%) Gaps:56/384 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 TESIVRSDSSYATLPLDFQQNFVRTTDNLRSEKAFLANRYGFSFAKSSGTATLKNTANMEYTCKM 154
            :|::||       :||..........|.::                      |||..:..|..|:
plant    15 SEALVR-------IPLQIDHALSTNNDGVQ----------------------LKNVKDFLYYGKI 50

  Fly   155 NIGTPKQKFTVLPDTGSSNIWVPGPHCKSKACKKHKQYHPAKSSTYVKNGKSFAITYGSGSVAGV 219
            .||.|.|.||||.|||||::|||..:..:|......:|..:.|.|:.:||....:.||.||:.|.
plant    51 QIGNPGQTFTVLFDTGSSSLWVPSENWLAKTENPRNRYISSASRTFKENGTKAELKYGKGSLTGF 115

  Fly   220 LAKDTVRIAGLVVTNQTFAMTTKEPGTTFVTS-NFDGILGLGYRSIAVDNVKTLV-QNMCSEDVI 282
            |:.|||.:.|:.:|:|||....|.|...|... .|||||||.:....  |..|.| .:|..:..|
plant   116 LSVDTVTVGGISITSQTFIEGVKTPYKEFFKKMPFDGILGLRFTDPL--NFGTSVWHSMVFQGKI 178

  Fly   283 TSCKFAICMKGGGSSS--RGGAIIFGSSNTSAYSGSNSYTYTPVTKKGYWQFTLQDIYVGGTKV- 344
            ....|:|.::...:|.  .||.::||....:.:||  .:||..|...|.: |.:.:|:|||... 
plant   179 AKNVFSIWLRRFSNSGEINGGEVVFGGIIPAHFSG--DHTYVDVEGPGNF-FAMSNIWVGGKNTN 240

  Fly   345 --SGSVQAIVDSGTSLITAPTAIYNKINKVIGCRATSSGECWMKCAKKIPDFTFVIAGKKFVVKG 407
              |...:||||||:|.|..|....::|::.||.....:.      .:.:||.||.|.||.||:..
plant   241 ICSSGCKAIVDSGSSNINVPMDSADEIHRYIGVEPNCNN------FETLPDVTFTIGGKAFVLTP 299

  Fly   408 NKMKLKVRTNRGRTVCISA-VTEVPDEPVILGDAFIRHFCTEFDLANN---RIGFAATT 462
            ...     ..|.|:.|.|. |.:.......||..|:|.|.|.||..|.   ::|||.:|
plant   300 LDY-----IRRSRSQCTSKFVGKTNRSHWTLGIPFMRVFHTVFDYQNTLAVKVGFAKST 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 111/327 (34%)
Asp 149..460 CDD:278455 109/321 (34%)
AT4G22050NP_193936.2 pepsin_retropepsin_like 36..351 CDD:386101 112/352 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.