DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and UND

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_193028.1 Gene:UND / 826904 AraportID:AT4G12920 Length:389 Species:Arabidopsis thaliana


Alignment Length:273 Identity:69/273 - (25%)
Similarity:109/273 - (39%) Gaps:71/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 MEYTCKMNIGTPKQKFTVLPDTGSSNIWV---PGPHCKSKACKKHKQYHPAKSSTY--------- 200
            :.:..:::.|:|::|..:..|||||..|.   |...|.::  |.:.:|.||.|.||         
plant    56 LAFMAEIHFGSPQKKQFLHMDTGSSLTWTQCFPCSDCYAQ--KIYPKYRPAASITYRDAMCEDSH 118

  Fly   201 VKNGKSFAI-------TY-----GSGSVAGVLAKDTV----------RIAGLVVTNQTFAMTTKE 243
            .|:...||.       ||     ...::.|.||::.:          |:.|:.     |...|..
plant   119 PKSNPHFAFDPLTRICTYQQHYLDETNIKGTLAQEMITVDTHDGGFKRVHGVY-----FGCNTLS 178

  Fly   244 PGTTFVTSNFDGILGLGYRSIAVDNVKTLVQNMCSEDVITSCKFAICMKGGGSSSRGGAIIFGSS 308
            .|:.|..:   ||||||....::      :....|       ||:.|:   |..|...|    |.
plant   179 DGSYFTGT---GILGLGVGKYSI------IGEFGS-------KFSFCL---GEISEPKA----SH 220

  Fly   309 NTSAYSGSNSYTYTPVTK--KGYWQFTLQDIYVG-GTKVSGSVQAIVDSGTSLITAPTAIYNK-- 368
            |.....|:|...:..|..  :|:..|.|:.|.|| ...:...||..||:|::|....|.:|.|  
plant   221 NLILGDGANVQGHPTVINITEGHTIFQLESIIVGEEITLDDPVQVFVDTGSTLSHLSTNLYYKFV 285

  Fly   369 --INKVIGCRATS 379
              .:.:||.|..|
plant   286 DAFDDLIGSRPLS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 69/273 (25%)
Asp 149..460 CDD:278455 69/272 (25%)
UNDNP_193028.1 pepsin_A_like_plant 57..387 CDD:133143 69/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.