DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and AT3G52500

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_566966.1 Gene:AT3G52500 / 824415 AraportID:AT3G52500 Length:469 Species:Arabidopsis thaliana


Alignment Length:435 Identity:92/435 - (21%)
Similarity:147/435 - (33%) Gaps:164/435 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AKSSGTATLKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNIWVP--------------------- 177
            |||.|          .|:..::.|||.|....:.|||||.:|:|                     
plant    84 AKSYG----------GYSVSLSFGTPSQTIPFVFDTGSSLVWLPCTSRYLCSGCDFSGLDPTLIP 138

  Fly   178 ------------------------GPHCKSKACKKHKQYHPAKSSTYVKNGKSFAITYGSGSVAG 218
                                    ||:.:.:.|..:.:........|:       :.||.||.||
plant   139 RFIPKNSSSSKIIGCQSPKCQFLYGPNVQCRGCDPNTRNCTVGCPPYI-------LQYGLGSTAG 196

  Fly   219 VLAKDTVRIAGLVVTNQTFA---MTTKEPGTTFVTSNFDGILGLGYRSIAVDNVKTLVQNMCSED 280
            ||..:.:....|.|.:....   ::|::|.         ||.|.|...:::.:...|.       
plant   197 VLITEKLDFPDLTVPDFVVGCSIISTRQPA---------GIAGFGRGPVSLPSQMNLK------- 245

  Fly   281 VITSCKFAICMKGGGSSSRGGAIIFGSSNTS------AYSGSNS------YTYTPVTKK------ 327
                 :|:.|:    .|.|     |..:|.:      ..||.||      .||||..|.      
plant   246 -----RFSHCL----VSRR-----FDDTNVTTDLDLDTGSGHNSGSKTPGLTYTPFRKNPNVSNK 296

  Fly   328 ---GYWQFTLQDIYVG-------------GTKVSGSVQAIVDSGTSLITAPTAIYNKINKVIGC- 375
               .|:...|:.||||             ||...|.  :|||||::.......::..:.:.... 
plant   297 AFLEYYYLNLRRIYVGRKHVKIPYKYLAPGTNGDGG--SIVDSGSTFTFMERPVFELVAEEFASQ 359

  Fly   376 -----------RATSSGECWMKCAK---KIPDFTFVIAGKKFVVKGNKMKLKVR-----TNRGRT 421
                       :.|..|.|:....|   .:|:..|...|      |.|::|.:.     .....|
plant   360 MSNYTREKDLEKETGLGPCFNISGKGDVTVPELIFEFKG------GAKLELPLSNYFTFVGNTDT 418

  Fly   422 VCISAVTEVPDEP-------VILGDAFIRHFCTEFDLANNRIGFA 459
            ||::.|::....|       :|||....:::..|:||.|:|.|||
plant   419 VCLTVVSDKTVNPSGGTGPAIILGSFQQQNYLVEYDLENDRFGFA 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 86/425 (20%)
Asp 149..460 CDD:278455 88/420 (21%)
AT3G52500NP_566966.1 PLN03146 22..468 CDD:178691 92/435 (21%)
pepsin_A_like_plant 89..467 CDD:133143 88/420 (21%)
pepsin_retropepsin_like 97..219 CDD:299705 25/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13683
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.