DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and AT2G23945

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_565559.1 Gene:AT2G23945 / 816927 AraportID:AT2G23945 Length:458 Species:Arabidopsis thaliana


Alignment Length:342 Identity:85/342 - (24%)
Similarity:129/342 - (37%) Gaps:94/342 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ESIVRSDSSYATLPLDFQQNFVRTTDNLRSEKAFLANRYGFSFAKSSGTATLKNTANMEYTCK-- 153
            ||:.|.:.: |.:|:..:.:....||...:...:|.|    |..|..|::..:  .::|...|  
plant    37 ESVARLNPN-ARVPITPEDHIKHLTDISSARFKYLQN----SIDKELGSSNFQ--VDVEQAIKTS 94

  Fly   154 -----MNIGTPKQKFTVLPDTGSSNIWV---PGPHCKSKACKKHKQYHPAKSSTYVK-------- 202
                 .::|.|......:.|||||.:|:   |..||.|.. ..|..::||.|||:|:        
plant    95 LFLVNFSVGQPPVPQLTIMDTGSSLLWIQCQPCKHCSSDH-MIHPVFNPALSSTFVECSCDDRFC 158

  Fly   203 -------NGKSFAITY------GSGSVAGVLAKDTVRIA---GLVVTNQTFAMTTKEPGTTFVTS 251
                   .|.|....|      |:|| .|||||:.:...   |..|..|..|..........:.|
plant   159 RYAPNGHCGSSNKCVYEQVYISGTGS-KGVLAKERLTFTTPNGNTVVTQPIAFGCGYENGEQLES 222

  Fly   252 NFDGILGLGYR--SIAVDNVKTLVQNMCSEDVITSCKFAICMKGGGSSSRG--------GAIIFG 306
            :|.||||||.:  |:||.               ...||:.|:....:.:.|        .|.|.|
plant   223 HFTGILGLGAKPTSLAVQ---------------LGSKFSYCIGDLANKNYGYNQLVLGEDADILG 272

  Fly   307 SSNTSAYSGSNSYTYTPVTKKGYWQFTLQDIYVGGTKVS----------GSVQAIVDSGTSLIT- 360
            ......:...||..|          ..|:.|.||.|:::          .....|:|||| |.| 
plant   273 DPTPIEFETENSIYY----------MNLEGISVGDTQLNIEPVVFKRRGPRTGVILDSGT-LYTW 326

  Fly   361 ----APTAIYNKINKVI 373
                |...:||:|..::
plant   327 LADIAYRELYNEIKSIL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 73/291 (25%)
Asp 149..460 CDD:278455 73/284 (26%)
AT2G23945NP_565559.1 PLN03146 7..450 CDD:178691 85/342 (25%)
pepsin_A_like_plant 96..448 CDD:133143 71/276 (26%)
pepsin_retropepsin_like 101..>151 CDD:299705 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.