DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and PGA4

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001073276.1 Gene:PGA4 / 643847 HGNCID:8886 Length:388 Species:Homo sapiens


Alignment Length:327 Identity:127/327 - (38%)
Similarity:186/327 - (56%) Gaps:18/327 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNIWVPGPHCKSKACKKHKQYHPAKSSTYVKNGKS 206
            |:|..:|||...:.||||.|.|||:.||||||:|||..:|.|.||..|.:::|..||||....::
Human    68 LENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSET 132

  Fly   207 FAITYGSGSVAGVLAKDTVRIAGLVVTNQTFAMTTKEPGTTFVTSNFDGILGLGYRSIAVDNVKT 271
            .:||||:||:.|:|..|||::.|:..|||.|.::..|||:....:.|||||||.|.||:......
Human   133 VSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATP 197

  Fly   272 LVQNMCSEDVITSCKFAICMKGGGSSSRGGAIIFGSSNTSAYSGSNSYTYTPVTKKGYWQFTLQD 336
            :..|:.::.:::...|::.:.....|  |..:|||..::|.|:|  |..:.|||.:||||.|:..
Human   198 VFDNIWNQGLVSQDLFSVYLSADDQS--GSVVIFGGIDSSYYTG--SLNWVPVTVEGYWQITVDS 258

  Fly   337 IYVGGTKV--SGSVQAIVDSGTSLITAPTAIYNKINKVIGCRATSSGECWMKCA--KKIPDFTFV 397
            |.:.|..:  :...|||||:||||:|.||:....|...||....|.|:..:.|:  ..:||..|.
Human   259 ITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFT 323

  Fly   398 IAGKKFVVKGNKMKLKVRTNRGRTVCISAV--TEVPDEP---VILGDAFIRHFCTEFDLANNRIG 457
            |.|.::.|..:...|:...:     |||..  ..:|.|.   .||||.|||.:.|.||.|||::|
Human   324 INGVQYPVPPSAYILQSEGS-----CISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVG 383

  Fly   458 FA 459
            .|
Human   384 LA 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 126/325 (39%)
Asp 149..460 CDD:278455 124/320 (39%)
PGA4NP_001073276.1 A1_Propeptide 17..45 CDD:311771
pepsin_A 66..386 CDD:133145 127/327 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.