DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and asp-19

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001123079.1 Gene:asp-19 / 6418790 WormBaseID:WBGene00077655 Length:223 Species:Caenorhabditis elegans


Alignment Length:220 Identity:63/220 - (28%)
Similarity:101/220 - (45%) Gaps:39/220 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 ANRYGFSFAKSSGTATLKNTANMEYTC--KMNIGTPKQKFTVLPDTGSSNIWVPGPHCKSKAC-- 186
            |||| |:|..|               |  .:.||||.|..:|..||.|:|.||.|..|.|..|  
 Worm    29 ANRY-FNFDDS---------------CIGNITIGTPPQSASVFMDTTSANWWVIGSKCTSANCNG 77

  Fly   187 ----KKHKQYHPAKSSTYVKNGKSFAITYGSGSVAGVLAKDTVRIAGLVVTNQTFAMTTKEPGTT 247
                :||| ::..||:::|:..::|:..|  |...|.|..|||::.||.:|.|...:.| ..|..
 Worm    78 YSGIRKHK-FNTTKSTSFVEGNRTFSTEY--GLCTGYLGTDTVQMGGLTITKQELGIAT-IVGLG 138

  Fly   248 FVTSNFDGILGLGYRSIAVDNVKTLVQNMCSEDVITSCKFAICMKGGGSSSRGGAIIFGSSNTSA 312
            |....:.||..|.:.:::||.|...:|.:.|::.:.:..|.|.:     ..:...:..|.:....
 Worm   139 FGLKPYVGIFELAWPALSVDQVTPPMQKLISQNQLDAPMFTIWL-----DQKDQGVYVGYTGLIT 198

  Fly   313 YSGSN------SYTYTPVTKKGYWQ 331
            |.|.:      :.||..::.|.:||
 Worm   199 YGGFDNKNCDANVTYVALSSKTFWQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 56/204 (27%)
Asp 149..460 CDD:278455 56/197 (28%)
asp-19NP_001123079.1 pepsin_like 40..>223 CDD:133138 53/191 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162042
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.